| New model in OGS2.0 | DPOGS215055 |
|---|---|
| Genomic Position | scaffold498:- 15171-16021 |
| See gene structure | |
| CDS Length | 294 |
| Paired RNAseq reads | 88 |
| Single RNAseq reads | 2071 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA005536 (5e-23) |
| Best Drosophila hit | zipper, isoform B (2e-07) |
| Best Human hit | ND |
| Best NR hit (blastp) | PREDICTED: similar to zipper CG15792-PD, isoform D [Apis mellifera] (3e-18) |
| Best NR hit (blastx) | PREDICTED: similar to zipper CG15792-PD, isoform D [Apis mellifera] (6e-10) |
| GeneOntology terms | GO:0016461 unconventional myosin complex GO:0007391 dorsal closure GO:0007443 Malpighian tubule morphogenesis GO:0007435 salivary gland morphogenesis GO:0008258 head involution GO:0005856 cytoskeleton GO:0007297 ovarian follicle cell migration GO:0003774 motor activity GO:0016459 myosin complex GO:0042623 ATPase activity, coupled GO:0035317 imaginal disc-derived wing hair organization GO:0030018 Z disc GO:0006936 muscle contraction GO:0045214 sarcomere organization GO:0030239 myofibril assembly GO:0016203 muscle attachment GO:0035072 ecdysone-mediated induction of salivary gland cell autophagic cell death GO:0045200 establishment of neuroblast polarity GO:0046663 dorsal closure, leading edge cell differentiation GO:0007395 dorsal closure, spreading of leading edge cells GO:0001736 establishment of planar polarity GO:0009653 anatomical structure morphogenesis GO:0000910 cytokinesis GO:0005524 ATP binding GO:0045179 apical cortex GO:0046664 dorsal closure, amnioserosa morphology change GO:0005938 cell cortex GO:0045184 establishment of protein localization GO:0032027 myosin light chain binding GO:0035017 cuticle pattern formation GO:0032154 cleavage furrow GO:0031036 myosin II filament assembly GO:0016460 myosin II complex GO:0051259 protein oligomerization GO:0035159 regulation of tube length, open tracheal system |
| InterPro families | ND |
| Orthology group | ND |
Nucleotide sequence:
ATGAACAGCCGCGTCAAGACGCTGAAGCGCGAGGTGGACGCCGCGGACGAGGAGGTGCAG
AGAGAGAGGGCCGCCAAGAGGAAGGCGCAGAGAGAGCTGGACGACCTACTGGAAGCGCAG
GAGACGCTCTCCAGGGAGTGCACCAACCTGCGCAACAAACTCAGGCGTCAAGGCGGTCCG
ATGTTGTCCGGGGCGTCGTCCGGTCGTGTGAAGCGCTCGTCCCTGGCCCCGGGGGGAGCC
TCCGGAGACGAATCCTTCGACGACGGCACCGACGCCGCCAACTCGCTCGAGTGA
Protein sequence:
MNSRVKTLKREVDAADEEVQRERAAKRKAQRELDDLLEAQETLSRECTNLRNKLRRQGGP
MLSGASSGRVKRSSLAPGGASGDESFDDGTDAANSLE