DPGLEAN00617 in OGS1.0

New model in OGS2.0DPOGS200451 
Genomic Positionscaffold4328:+ 10559-16067
See gene structure
CDS Length558
Paired RNAseq reads  30
Single RNAseq reads  346
Migratory profilesQuery via corresponding ESTs
Best Bmobyx hitBGIBMGA011231 (2e-32)
Best Drosophila hit  CG10069, isoform B (6e-17)
Best Human hitsugar phosphate exchanger 2 isoform 1 (4e-16)
Best NR hit (blastp)  PREDICTED: similar to conserved hypothetical protein [Tribolium castaneum] (1e-30)
Best NR hit (blastx)  PREDICTED: similar to conserved hypothetical protein [Tribolium castaneum] (5e-30)
GeneOntology terms


  
GO:0016021 integral to membrane
GO:0016020 membrane
GO:0055085 transmembrane transport
GO:0008643 carbohydrate transport
InterPro families  ND
Orthology groupND

Nucleotide sequence:

ATGAACGGTGTCAGCCGAGACGCACCTGTTGGTATACAATGCTTACAAAAATTCAGTTCC
TGGATGTGTCCGCGGTTACAGATAAATAGATTGCGATGGTATCAAGCCAGTGTTCTGGTG
TTGACGTACTTCACCTATATGACGTACCACCTGACGAGGAAGCCGATATCCGTGGTGAAG
AGCATTCTCCATCAGAACTGCAGCGGCTTGACGCCACCCCCGGACATCAGACCCGGGGAC
GACCAATGGTGTAATTGGGCGCCGTTTACACCGCAATACTGTAGGTATCAAGCCAGTGTT
CTGGTGTTGACGTACTTCACCTATATGACGTACCACCTGACGAGGAAGCCGATATCCGTG
GTGAAGAGCATTCTCCATCAGAACTGCAGCGGCTTGACGCCACCCCCGGACATCAGACCC
GGGGACGACCAATGGTGTAATTGGGCGCCGTTTAACACACATGATGCTAATACGCTATTG
GGTACACTGGATTCAGCTTTCTTGTTCTGCTACGCCGGAGCCATGTTTATATCTGGTAAG
GTAGTTACAAAAATTTAA

Protein sequence:

MNGVSRDAPVGIQCLQKFSSWMCPRLQINRLRWYQASVLVLTYFTYMTYHLTRKPISVVK
SILHQNCSGLTPPPDIRPGDDQWCNWAPFTPQYCRYQASVLVLTYFTYMTYHLTRKPISV
VKSILHQNCSGLTPPPDIRPGDDQWCNWAPFNTHDANTLLGTLDSAFLFCYAGAMFISGK
VVTKI