| New model in OGS2.0 | DPOGS211732 |
|---|---|
| Genomic Position | scaffold3216:- 3551-15680 |
| See gene structure | |
| CDS Length | 264 |
| Paired RNAseq reads | 0 |
| Single RNAseq reads | 7 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA013978 (4e-20) |
| Best Drosophila hit | patj, isoform B (2e-09) |
| Best Human hit | inaD-like protein (4e-09) |
| Best NR hit (blastp) | PREDICTED: inaD-like protein-like [Ailuropoda melanoleuca] (2e-08) |
| Best NR hit (blastx) | PREDICTED: inaD-like protein-like [Ailuropoda melanoleuca] (3e-07) |
| GeneOntology terms | GO:0005737 cytoplasm GO:0007163 establishment or maintenance of cell polarity GO:0016333 morphogenesis of follicular epithelium GO:0005635 nuclear envelope GO:0016324 apical plasma membrane GO:0016334 establishment or maintenance of polarity of follicular epithelium GO:0045186 zonula adherens assembly GO:0045196 establishment or maintenance of neuroblast polarity GO:0045179 apical cortex GO:0005886 plasma membrane GO:0016332 establishment or maintenance of polarity of embryonic epithelium GO:0035003 subapical complex GO:0007043 cell-cell junction assembly GO:0005918 septate junction GO:0002009 morphogenesis of an epithelium GO:0045176 apical protein localization GO:0005515 protein binding GO:0001736 establishment of planar polarity GO:0045494 photoreceptor cell maintenance GO:0034332 adherens junction organization GO:0008594 photoreceptor cell morphogenesis GO:0005875 microtubule associated complex |
| InterPro families | IPR001478 PDZ/DHR/GLGF |
| Orthology group | ND |
Nucleotide sequence:
ATGGACCCTCTTATCGCCAATTGGATGTTTCGTCCAGACATCGTTAAGGACGGCCGTCTC
CGTAGCGGCGATATGCTGTTACGTATTGGCGCTGTTTGTGTTGTTGGTATGTGCGCTCGT
CAGGCTGCTTCTGTGTTGCGGCAGTGCGGTGCCTGTGTCCGGCTGCTGGTGGCTAGACCA
GCGCATGGCGCTTTGCAGGCGGTGAGTTTGATCTCGTTTAATACATTTATAATTATATTT
ATTGTTGTAATATTTCTTTATTAA
Protein sequence:
MDPLIANWMFRPDIVKDGRLRSGDMLLRIGAVCVVGMCARQAASVLRQCGACVRLLVARP
AHGALQAVSLISFNTFIIIFIVVIFLY