DPGLEAN01151 in OGS1.0

New model in OGS2.0DPOGS202093 
Genomic Positionscaffold9385:- 702-1455
See gene structure
CDS Length300
Paired RNAseq reads  4
Single RNAseq reads  58
Migratory profilesQuery via corresponding ESTs
Best Bmobyx hitBGIBMGA002937 (2e-38)
Best Drosophila hit  nitric oxide synthase, isoform E (2e-26)
Best Human hitnitric oxide synthase, endothelial isoform 1 (7e-24)
Best NR hit (blastp)  nitric oxide synthase 2 [Bombyx mori] (6e-37)
Best NR hit (blastx)  nitric oxide synthase 2 [Bombyx mori] (6e-41)
GeneOntology terms














  
GO:0004517 nitric-oxide synthase activity
GO:0046620 regulation of organ growth
GO:0005516 calmodulin binding
GO:0008285 negative regulation of cell proliferation
GO:0006809 nitric oxide biosynthetic process
GO:0007444 imaginal disc development
GO:0008156 negative regulation of DNA replication
GO:0007416 synapse assembly
GO:0020037 heme binding
GO:0006952 defense response
GO:0005575 cellular_component
GO:0050660 FAD binding
GO:0055114 oxidation reduction
GO:0050661 NADP or NADPH binding
GO:0010181 FMN binding
GO:0007399 nervous system development
InterPro families  IPR004030 Nitric oxide synthase, oxygenase domain
Orthology groupMCL30903

Nucleotide sequence:

ATGGCCATCCCCGGTCGCGGCGACGTACCAAGGAATTCCGAAGAAGTGTTGAATGATGCC
AAAGATTTTCTCGGTCAATACTTCGCTTCCATAAGAAGAGCCAATACAGTAGCACATGAG
GCTCGTTGGAAAACTGTTCAAGAAGAAGTGGCCAAGACCGGGACATACCAGCTCACCACC
ACGGAGTTAGTATTTGGAGCAAAATTAGCCTGGAGAAACGCAAGTCGCTGCATTGGCAGA
ATACAGTGGTCCAAATTACAAGTAAGTAAAATTTCAACTAATATTATGTATATTTATTGA

Protein sequence:

MAIPGRGDVPRNSEEVLNDAKDFLGQYFASIRRANTVAHEARWKTVQEEVAKTGTYQLTT
TELVFGAKLAWRNASRCIGRIQWSKLQVSKISTNIMYIY