New model in OGS2.0 | DPOGS202093  |
---|---|
Genomic Position | scaffold9385:- 702-1455 |
See gene structure | |
CDS Length | 300 |
Paired RNAseq reads   | 4 |
Single RNAseq reads   | 58 |
Migratory profiles | Query via corresponding ESTs |
Best Bmobyx hit | BGIBMGA002937 (2e-38) |
Best Drosophila hit   | nitric oxide synthase, isoform E (2e-26) |
Best Human hit | nitric oxide synthase, endothelial isoform 1 (7e-24) |
Best NR hit (blastp)   | nitric oxide synthase 2 [Bombyx mori] (6e-37) |
Best NR hit (blastx)   | nitric oxide synthase 2 [Bombyx mori] (6e-41) |
GeneOntology terms    | GO:0004517 nitric-oxide synthase activity GO:0046620 regulation of organ growth GO:0005516 calmodulin binding GO:0008285 negative regulation of cell proliferation GO:0006809 nitric oxide biosynthetic process GO:0007444 imaginal disc development GO:0008156 negative regulation of DNA replication GO:0007416 synapse assembly GO:0020037 heme binding GO:0006952 defense response GO:0005575 cellular_component GO:0050660 FAD binding GO:0055114 oxidation reduction GO:0050661 NADP or NADPH binding GO:0010181 FMN binding GO:0007399 nervous system development |
InterPro families   | IPR004030 Nitric oxide synthase, oxygenase domain |
Orthology group | MCL30903 |
Nucleotide sequence:
ATGGCCATCCCCGGTCGCGGCGACGTACCAAGGAATTCCGAAGAAGTGTTGAATGATGCC
AAAGATTTTCTCGGTCAATACTTCGCTTCCATAAGAAGAGCCAATACAGTAGCACATGAG
GCTCGTTGGAAAACTGTTCAAGAAGAAGTGGCCAAGACCGGGACATACCAGCTCACCACC
ACGGAGTTAGTATTTGGAGCAAAATTAGCCTGGAGAAACGCAAGTCGCTGCATTGGCAGA
ATACAGTGGTCCAAATTACAAGTAAGTAAAATTTCAACTAATATTATGTATATTTATTGA
Protein sequence:
MAIPGRGDVPRNSEEVLNDAKDFLGQYFASIRRANTVAHEARWKTVQEEVAKTGTYQLTT
TELVFGAKLAWRNASRCIGRIQWSKLQVSKISTNIMYIY