| New model in OGS2.0 | DPOGS205603 |
|---|---|
| Genomic Position | scaffold705:- 41923-42093 |
| See gene structure | |
| CDS Length | 171 |
| Paired RNAseq reads | 0 |
| Single RNAseq reads | 4 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA007207 (5e-26) |
| Best Drosophila hit | futsch, isoform C (2e-10) |
| Best Human hit | ND |
| Best NR hit (blastp) | hypothetical protein TcasGA2_TC001001 [Tribolium castaneum] (4e-10) |
| Best NR hit (blastx) | hypothetical protein TcasGA2_TC001001 [Tribolium castaneum] (2e-09) |
| GeneOntology terms | GO:0008017 microtubule binding GO:0005875 microtubule associated complex GO:0015630 microtubule cytoskeleton GO:0048813 dendrite morphogenesis GO:0007409 axonogenesis GO:0008582 regulation of synaptic growth at neuromuscular junction GO:0000226 microtubule cytoskeleton organization GO:0007017 microtubule-based process GO:0005515 protein binding GO:0048749 compound eye development GO:0007399 nervous system development GO:0007528 neuromuscular junction development GO:0008088 axon cargo transport GO:0043524 negative regulation of neuron apoptosis GO:0060052 neurofilament cytoskeleton organization GO:0008355 olfactory learning |
| InterPro families | ND |
| Orthology group | MCL21870 |
Nucleotide sequence:
ATGGACCACGACGAGGACAGGTCCCTGTCGCTGGGGACGGAGGTTTCGGCCTCCGTGCCC
CCCCCTAGCCCCCTGACGGGATGCTATCTGCTGGCCGTCATCGGCGAACCCCATACTCAT
GAGCACAAGGAGATCATTTTGCAGCGGCTCGTCAAAGGTGGGTCATTTTAG
Protein sequence:
MDHDEDRSLSLGTEVSASVPPPSPLTGCYLLAVIGEPHTHEHKEIILQRLVKGGSF