| New model in OGS2.0 | DPOGS211515 |
|---|---|
| Genomic Position | scaffold5612:+ 3697-3846 |
| See gene structure | |
| CDS Length | 150 |
| Paired RNAseq reads | 0 |
| Single RNAseq reads | 17 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA003819 (2e-19) |
| Best Drosophila hit | GIIIspla2 (9e-08) |
| Best Human hit | ND |
| Best NR hit (blastp) | PREDICTED: similar to secretory Phospholipase A2, putative [Nasonia vitripennis] (2e-13) |
| Best NR hit (blastx) | PREDICTED: similar to secretory Phospholipase A2, putative [Nasonia vitripennis] (5e-14) |
| GeneOntology terms | GO:0004623 phospholipase A2 activity GO:0005576 extracellular region GO:0006644 phospholipid metabolic process GO:0005509 calcium ion binding GO:0016042 lipid catabolic process |
| InterPro families | IPR001211 Phospholipase A2, eukaryotic IPR016090 Phospholipase A2 |
| Orthology group | MCL39781 |
Nucleotide sequence:
ATGGTTGGGAAATTATTTTTTAATATTGTCCAAACCAAATGTTTCATTTTAAAACCGATG
AAGGTGTGCACGGAGAGGTCGTGGTGGGGGAAATGTCTTCGTCACGGTTCTATGAAGCAG
GCGTTTCTAAGAGACAATCTACCATACTGA
Protein sequence:
MVGKLFFNIVQTKCFILKPMKVCTERSWWGKCLRHGSMKQAFLRDNLPY