DPGLEAN03760 in OGS1.0

New model in OGS2.0DPOGS212592 
Genomic Positionscaffold2173:- 12983-17176
See gene structure
CDS Length993
Paired RNAseq reads  52
Single RNAseq reads  240
Migratory profilesQuery via corresponding ESTs
Best Bmobyx hitBGIBMGA005193 (2e-14)
Best Drosophila hit  neither inactivation nor afterpotential B (9e-51)
Best Human hitbeta,beta-carotene 15,15'-monooxygenase (1e-35)
Best NR hit (blastp)  neither inactivation nor afterpotential B [Galleria mellonella] (5e-76)
Best NR hit (blastx)  neither inactivation nor afterpotential B [Galleria mellonella] (3e-74)
GeneOntology terms






  
GO:0007604 phototransduction, UV
GO:0007603 phototransduction, visible light
GO:0016063 rhodopsin biosynthetic process
GO:0007602 phototransduction
GO:0003834 beta-carotene 15,15'-monooxygenase activity
GO:0035238 vitamin A biosynthetic process
GO:0009110 vitamin biosynthetic process
GO:0016119 carotene metabolic process
InterPro families  IPR004294 Carotenoid oxygenase
Orthology groupND

Nucleotide sequence:

ATGCCCAAAACTAAAATAGAAAATTTTGCGACTCAGTCATGGACAACGCCGATGTTAAGG
ACGTGTACGCAAGAAATTACAAATCCTTTAGAGGGTAAAGTTTCAGGGAGTATTCCGTCT
TGGCTTCAAGGAACGCTGATAAGAAATGGATCTGGTGCCATCAAAATTGGCAATTCTGAG
TTTGGTCATGTCTTTGACGGATCATCGCTGCTTCACAGATTTTCGATTAAGGGTGGTCGG
GCAACATATCAATGTAGGTTCCTAGATTCAAAAACATTAAGAAAAAACAGAGCTGCTAAT
CGTATTGTGGTCACAGAATTTGCCACGGAAGCTGTTCCAGATCCTTGCCACACAATATTT
GATAGAATATCAACCATTTTCAACCCTGCAGAGGCAGTCACTGATAATTGTGGAATATCT
GTATATCCTTTCGGAGATCAGATGTATGCCATGACAGAATATACTAATGTTTACAAAATT
GACACTGAATCTCTCGATACATTAGAAAAGAAGAGTCTTTTAAATTCATTAATCGTCTGC
CACACAGCGCACCCACATGTAATGAAAAATGGAGACGTTTACAATATAGCTCTTGGCGTG
GTTAAGGGGCTATTAAAACACATGATTGTCAAATTTCCTTACACAGAAAAAGGACGACCC
TATCGATACTTTTACGGAATGGGCCCACAGGTGCACTCAATTTATGGCGGAACGATAATT
AAAGTTGATACTAAAAGCGGTGAAGTGAAGACATGGTGTGAAGTGGACGCAAATCCGAGC
GAGCCTGTATTTGTTGCCCGACCGGATGCTCAGGATGAAGATGATGGTGTACTATTGAGT
GCCTTACTTTGGGGCAGTGACGAGAATGCAACAGCACTCCTCGTGTTGGACGCCCGAGAT
CTCACAGAACTCGGACGTGTTAGGTTTACAACACCCTCGCAGGCACCCAAGTGCTTTCAC
GGGTGGTTTCTACCCGACACGAATTCAACTTGA

Protein sequence:

MPKTKIENFATQSWTTPMLRTCTQEITNPLEGKVSGSIPSWLQGTLIRNGSGAIKIGNSE
FGHVFDGSSLLHRFSIKGGRATYQCRFLDSKTLRKNRAANRIVVTEFATEAVPDPCHTIF
DRISTIFNPAEAVTDNCGISVYPFGDQMYAMTEYTNVYKIDTESLDTLEKKSLLNSLIVC
HTAHPHVMKNGDVYNIALGVVKGLLKHMIVKFPYTEKGRPYRYFYGMGPQVHSIYGGTII
KVDTKSGEVKTWCEVDANPSEPVFVARPDAQDEDDGVLLSALLWGSDENATALLVLDARD
LTELGRVRFTTPSQAPKCFHGWFLPDTNST