DPGLEAN04077 in OGS1.0

Genomic Positionscaffold2700:+ 152-627
See gene structure
CDS Length255
Paired RNAseq reads  732
Single RNAseq reads  17666
Migratory profilesQuery via corresponding ESTs
Best Bmobyx hitBGIBMGA002164 (9e-34)
Best Drosophila hit  ribosomal protein L35A (1e-25)
Best Human hit60S ribosomal protein L35a (2e-26)
Best NR hit (blastp)  ribosomal protein L35A [Bombyx mori] (5e-37)
Best NR hit (blastx)  ribosomal protein L35A [Bombyx mori] (4e-37)
GeneOntology terms



  
GO:0003735 structural constituent of ribosome
GO:0005622 intracellular
GO:0006412 translation
GO:0005840 ribosome
GO:0009790 embryo development
InterPro families

  
IPR001780 Ribosomal protein L35A
IPR018266 Ribosomal protein L35Ae, conserved site
IPR009000 Translation elongation/initiation factor/Ribosomal, beta-barrel
Orthology groupMCL12513

Nucleotide sequence:

ATCGAAGGTGCTCGCAATCGCGATGACGCAGAGTTCTACGCCGGCAAGAAGTGCGTGTAC
GTGTACCGCGCCAAGAAGAGGACGGCCATCCCCGGTGGACCGCGAGGCAAGAAGACGAAG
CTGCGCGCCATCTGGGGCAAGGTGACTCGCTCCCACGGCAACGGCGGCTCCGTGCGAGCA
CGCTTCAAGTCCAACCTCCCCGCACAGGCCATGGGACACAGGATACGAGTGATGTTGTAT
CCCTCACGGATTTAA

Protein sequence:

IEGARNRDDAEFYAGKKCVYVYRAKKRTAIPGGPRGKKTKLRAIWGKVTRSHGNGGSVRA
RFKSNLPAQAMGHRIRVMLYPSRI