DPGLEAN04350 in OGS1.0

New model in OGS2.0DPOGS200935 
Genomic Positionscaffold267:+ 50771-54441
See gene structure
CDS Length588
Paired RNAseq reads  625
Single RNAseq reads  1876
Migratory profilesQuery via corresponding ESTs
Best Bmobyx hitBGIBMGA000305 (8e-10)
Best Drosophila hit  CG4666 (6e-62)
Best Human hitmesenchymal stem cell protein DSCD75 precursor (2e-26)
Best NR hit (blastp)  mesenchymal stem cell protein DSCD75 [Culex quinquefasciatus] (1e-67)
Best NR hit (blastx)  mesenchymal stem cell protein DSCD75 [Culex quinquefasciatus] (2e-65)
GeneOntology terms

  
GO:0003674 molecular_function
GO:0008150 biological_process
GO:0005575 cellular_component
InterPro families  ND
Orthology groupMCL13031

Nucleotide sequence:

ATGTATTGTTTTATTGTAGCGTTAGTTCTGCTATCATATATATTCTTCGACGTTAACTAT
TTTATTCGTGTTGCTTTCACAATTTTGTTTGGAAGACTGTTTCAAAAGAAATGCGGTGTT
AATGACTCCACAACAATTTACGGAATATGTACCACCCAGGATGTCGACATCTTCTTGCGA
CACATGAATAATGCTCGTTACGTGAGAGATTTGGACTTCGCAAGGTTCCATTTCTATGAC
AGGACCGGCATCTATAGGAATATTAAGGAAGTCGACGGACATGTCCTCCAGGGCGCATCC
AGTATACGATACCGTAGAACCATTCCCATATTTAATGCATACAAAGTGGAGACGAGGTTG
GTGTATTGGGAAGACAAATCTCTGTTCATAGAACAAAAGTTCATAACGTTGCATGACGGT
TTCGTCCGTGCCATAGTACTATCCCGTCAGAACCTTATTAACATCGACGCTGATGGTCTT
CTCAAGAACATTCCGGGAGTCGAGAAGAAACCCGAATGCCCCGAAGAGATCAAACACTGG
CTGCAGGCCATTGAGATATCCAGCGCGAGACTGCGCAAGAAGGATTAA

Protein sequence:

MYCFIVALVLLSYIFFDVNYFIRVAFTILFGRLFQKKCGVNDSTTIYGICTTQDVDIFLR
HMNNARYVRDLDFARFHFYDRTGIYRNIKEVDGHVLQGASSIRYRRTIPIFNAYKVETRL
VYWEDKSLFIEQKFITLHDGFVRAIVLSRQNLINIDADGLLKNIPGVEKKPECPEEIKHW
LQAIEISSARLRKKD