| New model in OGS2.0 | DPOGS213931 |
|---|---|
| Genomic Position | scaffold6599:- 4577-4762 |
| See gene structure | |
| CDS Length | 186 |
| Paired RNAseq reads | 0 |
| Single RNAseq reads | 6 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA009081 (2e-24) |
| Best Drosophila hit | shaker cognate w, isoform A (2e-23) |
| Best Human hit | potassium voltage-gated channel subfamily C member 4 isoform c (3e-18) |
| Best NR hit (blastp) | AGAP008202-PA [Anopheles gambiae str. PEST] (2e-21) |
| Best NR hit (blastx) | PREDICTED: similar to AGAP008200-PA [Acyrthosiphon pisum] (1e-20) |
| GeneOntology terms | GO:0005886 plasma membrane GO:0016021 integral to membrane GO:0005249 voltage-gated potassium channel activity GO:0006813 potassium ion transport GO:0008076 voltage-gated potassium channel complex GO:0055085 transmembrane transport GO:0005515 protein binding GO:0030431 sleep |
| InterPro families | IPR013099 Ion transport 2 IPR015572 Voltage-dependent potassium channel Kv3, invertebrate |
| Orthology group | ND |
Nucleotide sequence:
ATGACGACGGTGGGCTATGGAGACATGGCGCCCAAGACTTATTTGGGGATGTTCGTGGGC
GCCCTCTGTGCGCTGGCTGGCGTGCTCACTATAGCGTTGCCAGTTCCTGTCATTGTATCA
AATTTCTCTATGTTTTATTCACACACGCAGGTAAGTTTGTATTTTATAAATATATATTTA
GGTTAA
Protein sequence:
MTTVGYGDMAPKTYLGMFVGALCALAGVLTIALPVPVIVSNFSMFYSHTQVSLYFINIYL
G