New model in OGS2.0 | DPOGS201142  |
---|---|
Genomic Position | scaffold684:- 10287-10830 |
See gene structure | |
CDS Length | 312 |
Paired RNAseq reads   | 49 |
Single RNAseq reads   | 285 |
Migratory profiles | Query via corresponding ESTs |
Best Bmobyx hit | BGIBMGA003946 (6e-43) |
Best Drosophila hit   | deterin (4e-15) |
Best Human hit | baculoviral IAP repeat-containing protein 5 isoform 1 (6e-16) |
Best NR hit (blastp)   | inhibition of apoptosis protein 2 [Bombyx mori] (4e-41) |
Best NR hit (blastx)   | inhibition of apoptosis protein 2 [Bombyx mori] (1e-41) |
GeneOntology terms    | GO:0000086 G2/M transition of mitotic cell cycle GO:0000775 chromosome, centromeric region GO:0000910 cytokinesis GO:0005737 cytoplasm GO:0005814 centriole GO:0005829 cytosol GO:0005876 spindle microtubule GO:0005881 cytoplasmic microtubule GO:0006916 anti-apoptosis GO:0008017 microtubule binding GO:0008270 zinc ion binding GO:0015631 tubulin binding GO:0030496 midbody GO:0031021 interphase microtubule organizing center GO:0031503 protein complex localization GO:0031536 positive regulation of exit from mitosis GO:0031577 spindle checkpoint GO:0032133 chromosome passenger complex GO:0042803 protein homodimerization activity GO:0043027 caspase inhibitor activity GO:0043154 negative regulation of caspase activity GO:0045931 positive regulation of mitotic cell cycle GO:0048037 cofactor binding GO:0051301 cell division GO:0051303 establishment of chromosome localization |
InterPro families   | IPR001370 Baculoviral inhibition of apoptosis protein repeat |
Orthology group | MCL15790 |
Nucleotide sequence:
ATGGCAGAGGCAGGATTTTATTCAGTGGCCACTGGCGAAGATGACGCTGACGCTGCGAAA
TGTTTTCTCTGCGGTAAGGAATTGGATGGTTGGGAAGCTGATGACGACCCATGGGGAGAA
CATAAAAGTCACGCTGCCAAGTGTGCGTTCGTGCAACTTGGTAAAAAGGAAGACGAATTA
CTATTGTCAGAAATGTTGTCAGTTGTCAAACAATACATGGTAAATGAAGTCAAACATGTT
GCAGAGGTTACAAAGGAAAAAATTGATGAGAGAGCCAAACTAGTTAAAAGACAATGCATG
ACGAGGAAATGA
Protein sequence:
MAEAGFYSVATGEDDADAAKCFLCGKELDGWEADDDPWGEHKSHAAKCAFVQLGKKEDEL
LLSEMLSVVKQYMVNEVKHVAEVTKEKIDERAKLVKRQCMTRK