| New model in OGS2.0 | DPOGS207578 |
|---|---|
| Genomic Position | scaffold12219:+ 56-208 |
| See gene structure | |
| CDS Length | 153 |
| Paired RNAseq reads | 1 |
| Single RNAseq reads | 34 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA004729 (1e-23) |
| Best Drosophila hit | twinfilin (5e-16) |
| Best Human hit | twinfilin-1 (5e-10) |
| Best NR hit (blastp) | PREDICTED: similar to CG3172-PA [Nasonia vitripennis] (2e-15) |
| Best NR hit (blastx) | PREDICTED: similar to CG3172-PA [Nasonia vitripennis] (1e-15) |
| GeneOntology terms | GO:0003779 actin binding GO:0005737 cytoplasm GO:0005886 plasma membrane GO:0030833 regulation of actin filament polymerization |
| InterPro families | ND |
| Orthology group | ND |
Nucleotide sequence:
CTGGAAATAGATGACGGTAAAGAATTAACTGAAGATTATCTATATGATGAAATTCACCCA
AAAAGAAACTTACACAGACCAGCCTTCGCCAAACCGAAGGGCCCTCCGAATAGAGGCGCC
AAGAGAATCACTAAAGCGCAGTCCACTCAATAA
Protein sequence:
LEIDDGKELTEDYLYDEIHPKRNLHRPAFAKPKGPPNRGAKRITKAQSTQ