| Genomic Position | scaffold12135:+ 1175-1895 |
|---|---|
| See gene structure | |
| CDS Length | 327 |
| Paired RNAseq reads | 22 |
| Single RNAseq reads | 590 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA006232 (1e-53) |
| Best Drosophila hit | DP transcription factor, isoform A (1e-34) |
| Best Human hit | transcription factor Dp-1 (6e-31) |
| Best NR hit (blastp) | PREDICTED: similar to transcription factor Dp-2 (E2F dimerization partner 2) [Apis mellifera] (1e-37) |
| Best NR hit (blastx) | PREDICTED: similar to transcription factor Dp-2 (E2F dimerization partner 2) [Apis mellifera] (1e-36) |
| GeneOntology terms | GO:0003677 DNA binding GO:0005515 protein binding GO:0035189 Rb-E2F complex GO:0051726 regulation of cell cycle GO:0003702 RNA polymerase II transcription factor activity GO:0005634 nucleus GO:0003704 specific RNA polymerase II transcription factor activity GO:0006357 regulation of transcription from RNA polymerase II promoter GO:0048477 oogenesis GO:0008069 dorsal/ventral axis specification, ovarian follicular epithelium GO:0045850 positive regulation of nurse cell apoptosis GO:0045476 nurse cell apoptosis GO:0007307 eggshell chorion gene amplification GO:0007113 endomitotic cell cycle GO:0007049 cell cycle GO:0003700 sequence-specific DNA binding transcription factor activity GO:0006355 regulation of transcription, DNA-dependent GO:0031523 Myb complex GO:0010628 positive regulation of gene expression |
| InterPro families | IPR014889 Transcription factor DP, C-terminal IPR015648 Transcription factor DP |
| Orthology group | ND |
Nucleotide sequence:
CATATATCATTCAAAAGTTTAATAGAAAGAAATAAAGAAGCTGAAAATAAAGGTATAAAA
CCTTCACCATCCTCAGCAATCCACCTGCCATTTATAGTTGTAAATACAAGTGACAAAGCA
CTGATTGATTGTAGCATCTCTAATGATAAGACGGAGTATATGTTTAATTTTAATAAGAGA
TTTCAAATTCATGATGACATTGATATTTTAAAAAGAATGGGACTTCTTTATGGATTAGAC
AAGGGAGAGTGTACAGAAGAAGAAATCGAAAAAGTCAAAAGTATGGTACCAAAATCTTTA
GAAAGTTATGTAGAACGCGGAGCTTAG
Protein sequence:
HISFKSLIERNKEAENKGIKPSPSSAIHLPFIVVNTSDKALIDCSISNDKTEYMFNFNKR
FQIHDDIDILKRMGLLYGLDKGECTEEEIEKVKSMVPKSLESYVERGA