DPGLEAN07887 in OGS1.0

New model in OGS2.0DPOGS204724 
Genomic Positionscaffold118:+ 29082-30008
See gene structure
CDS Length927
Paired RNAseq reads  15
Single RNAseq reads  64
Migratory profilesQuery via corresponding ESTs
Best Bmobyx hitBGIBMGA008250 (2e-08)
Best Drosophila hit  crooked legs, isoform A (6e-37)
Best Human hitzinc finger protein 569 (1e-47)
Best NR hit (blastp)  hypothetical protein LOC100151757 [Danio rerio] (7e-54)
Best NR hit (blastx)  hypothetical protein BRAFLDRAFT_67486 [Branchiostoma floridae] (7e-62)
GeneOntology terms


  
GO:0005622 intracellular
GO:0003676 nucleic acid binding
GO:0008270 zinc ion binding
GO:0008150 biological_process
InterPro families

  
IPR015880 Zinc finger, C2H2-like
IPR007087 Zinc finger, C2H2-type
IPR013087 Zinc finger, C2H2-type/integrase, DNA-binding
Orthology groupMCL40246

Nucleotide sequence:

ATGAGGACCCATACTGGAGAAAAACCTTTCATGTGTATGGCATGTAATACTAAATTCCCC
ACTAAAGGATCCTTAAAGAGACACAATGAAACCTACCACTTAGCTAGGGAGAGAAAATTT
ACCTGTGAGACCTGTGGCAGCAGCTTTTTTAGGAAAAATGATATAATAACACATATGAGA
GTTCACACAGATGAGAGACCATATGTTTGTCAATACTGTTCTAAAAGGTTCCGACAAGTT
GCCTCACGCAATAGACATCAGATTGTTCACACTGGAGAGAAACCATATGCATGTCCCATA
TGTGATAAGAAATTTGCTCATAAAAGCCTTGTCACCAAACACCAAAGTGTTCATAGTGAT
GAGAAAAAATACACTTGCCACCTATGTAGCAAGTCCATGAAGTCCCGAACAGCTTTAAAT
GTCCACATAGGGCTACACACTAACGAGAAACAGAATGTGTGTAGTTTCTGTGGAATGGCT
TTCGCCATGAAGGGTAACTTACAGACGCATATCAGAAGAATACACTCTGAGAAATCTGGT
CAGTGTTCCACTTGTTTAAAGACATTTTCAGATTTACAAGTGCATATGAGAAAGCATACA
GGTGAAAAGCCATACATATGTGGAACTTGCAATGCTGCCTTCTCTGTTAAAAGGAGTTTA
GCCCACCACATGATGTTCAAGCATGAAAACGCCGGAAAATACAAATGTTCTATTGGTGAC
TGCTCCAAAACCTTCCCTACGGCGACAATGCTCGAGTTCCACCTAATGAAGCAGCACACT
AACCATACGCCCTATACCTGTCAACATTGCCCACGAAGGTTCTTCAGAACTAGTGATCTC
TCCCGTCACCTACGAGCTAGTCATATGGACATACAATTTAAGCCTCCGCTCAAAACTCTC
CTACCCAAAACTATGTCTTTCGCTTAA

Protein sequence:

MRTHTGEKPFMCMACNTKFPTKGSLKRHNETYHLARERKFTCETCGSSFFRKNDIITHMR
VHTDERPYVCQYCSKRFRQVASRNRHQIVHTGEKPYACPICDKKFAHKSLVTKHQSVHSD
EKKYTCHLCSKSMKSRTALNVHIGLHTNEKQNVCSFCGMAFAMKGNLQTHIRRIHSEKSG
QCSTCLKTFSDLQVHMRKHTGEKPYICGTCNAAFSVKRSLAHHMMFKHENAGKYKCSIGD
CSKTFPTATMLEFHLMKQHTNHTPYTCQHCPRRFFRTSDLSRHLRASHMDIQFKPPLKTL
LPKTMSFA