| New model in OGS2.0 | DPOGS213816 |
|---|---|
| Genomic Position | scaffold676:- 9767-9922 |
| See gene structure | |
| CDS Length | 156 |
| Paired RNAseq reads | 0 |
| Single RNAseq reads | 40 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA006556 (2e-18) |
| Best Drosophila hit | bazooka, isoform A (9e-14) |
| Best Human hit | partitioning defective 3 homolog isoform 2 (5e-08) |
| Best NR hit (blastp) | PREDICTED: similar to partitioning defective 3, par-3 [Tribolium castaneum] (5e-14) |
| Best NR hit (blastx) | PREDICTED: similar to partitioning defective 3, par-3 [Tribolium castaneum] (9e-13) |
| GeneOntology terms | GO:0021535 cell migration in hindbrain GO:0005515 protein binding GO:0048048 embryonic eye morphogenesis GO:0045197 establishment or maintenance of epithelial cell apical/basal polarity GO:0043010 camera-type eye development GO:0051660 establishment of centrosome localization GO:0016324 apical plasma membrane GO:0005737 cytoplasm |
| InterPro families | IPR021922 Protein of unknown function DUF3534 |
| Orthology group | MCL24156 |
Nucleotide sequence:
ATGAAGGTGACGGTGTGTTTTGGTTCCGTGCGGGTTTTGGTACCTTGTGGCGCTGGCGAC
CTCTTAGTCAGGGACCTCGTACGGGAAGCTACGCTCCGATACAAAAAGGCTACTGGACAG
GTCAGTTTTTTTTTCAATTTACTAGTTCCGTCATAG
Protein sequence:
MKVTVCFGSVRVLVPCGAGDLLVRDLVREATLRYKKATGQVSFFFNLLVPS