DPGLEAN08226 in OGS1.0

New model in OGS2.0DPOGS208122 
Genomic Positionscaffold61:- 28698-31155
See gene structure
CDS Length555
Paired RNAseq reads  173
Single RNAseq reads  866
Migratory profilesQuery via corresponding ESTs
Best Bmobyx hitBGIBMGA006774 (3e-83)
Best Drosophila hit  CG8776, isoform A (2e-38)
Best Human hitcytochrome b ascorbate-dependent protein 3 isoform 2 (4e-20)
Best NR hit (blastp)  hypothetical protein TcasGA2_TC012618 [Tribolium castaneum] (3e-58)
Best NR hit (blastx)  hypothetical protein TcasGA2_TC012618 [Tribolium castaneum] (5e-57)
GeneOntology terms

  
GO:0030133 transport vesicle
GO:0009055 electron carrier activity
GO:0016021 integral to membrane
InterPro families
  
IPR004877 Cytochrome b561, eukaryote
IPR006593 Cytochrome b561/ferric reductase transmembrane
Orthology groupMCL17452

Nucleotide sequence:

ATGGTGGCTGGATTTGTCACCTTTAGCGGTTTTTCGGTGCTGCTCTACCGCATCTGCCGC
TGCTTCAGACGTATTTACGTGAAACTTCTGCACGCTATCTTCCATGCATTGGCGTTCCCA
TGCATCGTGATCGGTTTCCTCGCGGTATTGGACTTCCATAACAAGAAGGGGATTAATAAT
TTCTATTCCCTTCATAGCTGGATAGGATTGGTCGCTATGGGACTATTTGGAATTCAGTAT
GCGGTTGGTTTCTTCAGTTTTCTTCTGCTATTGATTTGTAACAAAGGAACCGCGAACTTC
CGTGCTTCGTTGGTGCCAATTCACGCCGCTTTTGGAATTCTGACCTTTGTTCTTGGAGTA
TGCGCTTGTCTTACTGGACTCACCGAAAAGGCTCTCTTCACTCTGGGGAGCGAGACATAC
GCCTCGATGTCCACCGAGGGTATTGTGATTAACGCCATCGGGATGTCGGTGGTGGCCGTG
GCGATCGTGGTGCTGTACACCGTCCGTGGTACAGGAGGATACAGACTTCGCAAAGTGGCT
CAGAATCCGAGTTAA

Protein sequence:

MVAGFVTFSGFSVLLYRICRCFRRIYVKLLHAIFHALAFPCIVIGFLAVLDFHNKKGINN
FYSLHSWIGLVAMGLFGIQYAVGFFSFLLLLICNKGTANFRASLVPIHAAFGILTFVLGV
CACLTGLTEKALFTLGSETYASMSTEGIVINAIGMSVVAVAIVVLYTVRGTGGYRLRKVA
QNPS