| New model in OGS2.0 | DPOGS210739 |
|---|---|
| Genomic Position | scaffold6444:+ 224-903 |
| See gene structure | |
| CDS Length | 150 |
| Paired RNAseq reads | 0 |
| Single RNAseq reads | 49 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA006271 (2e-17) |
| Best Drosophila hit | CG42322, isoform J (2e-13) |
| Best Human hit | ND |
| Best NR hit (blastp) | PREDICTED: similar to CG31203-PA, isoform A [Apis mellifera] (6e-13) |
| Best NR hit (blastx) | PREDICTED: similar to CG31203-PA, isoform A [Apis mellifera] (6e-13) |
| GeneOntology terms | GO:0016020 membrane |
| InterPro families | ND |
| Orthology group | ND |
Nucleotide sequence:
ATGTACACGTATGCCTTGAAGATACTTCTATCTACTGATGTGGTGGCATTGTTTGCTACT
AATGTATCCTGCGTGTATCTCCTCTCGTGGGTGATACTTCATGAGCAGTTTGTTGGCGTG
AGGCATGCTTTTCTGATCGAACTAATATAA
Protein sequence:
MYTYALKILLSTDVVALFATNVSCVYLLSWVILHEQFVGVRHAFLIELI