New model in OGS2.0 | DPOGS203383  |
---|---|
Genomic Position | scaffold6:+ 405663-405839 |
See gene structure | |
CDS Length | 177 |
Paired RNAseq reads   | 0 |
Single RNAseq reads   | 42 |
Migratory profiles | Query via corresponding ESTs |
Best Bmobyx hit | BGIBMGA002046 (4e-15) |
Best Drosophila hit   | luna (1e-07) |
Best Human hit | Krueppel-like factor 6 isoform C (4e-06) |
Best NR hit (blastp)   | conserved hypothetical protein [Pediculus humanus corporis] (8e-08) |
Best NR hit (blastx)   | conserved hypothetical protein [Pediculus humanus corporis] (3e-07) |
GeneOntology terms    | GO:0045449 regulation of transcription GO:0003700 sequence-specific DNA binding transcription factor activity GO:0005634 nucleus GO:0006355 regulation of transcription, DNA-dependent GO:0003677 DNA binding GO:0008270 zinc ion binding |
InterPro families   | ND |
Orthology group | MCL18042 |
Nucleotide sequence:
ATGGATGTTCTTCCGAGCGGTAACCTATTCCGCGAGTTGCAGGACGTCACCGACACCGGT
TATTTCGAATGGAAGCTTTCTTTGGAAGATTATTGGCAACAGGTAAGTGATGCTGAGCGA
GGATTTACCAAAAATGACAAGCTATGCAAGCAAGCGAGCTGGCGCATTATTGTTTAA
Protein sequence:
MDVLPSGNLFRELQDVTDTGYFEWKLSLEDYWQQVSDAERGFTKNDKLCKQASWRIIV