DPGLEAN09092 in OGS1.0

New model in OGS2.0DPOGS201707 
Genomic Positionscaffold448:- 43679-44607
See gene structure
CDS Length516
Paired RNAseq reads  248
Single RNAseq reads  867
Migratory profilesQuery via corresponding ESTs
Best Bmobyx hitBGIBMGA010792 (9e-47)
Best Drosophila hit  CG2789 (3e-28)
Best Human hittranslocator protein isoform PBR (1e-28)
Best NR hit (blastp)  peripheral-type benzodiazepine receptor [Bombyx mori] (2e-47)
Best NR hit (blastx)  peripheral-type benzodiazepine receptor [Bombyx mori] (1e-44)
GeneOntology terms




































  
GO:0004872 receptor activity
GO:0005497 androgen binding
GO:0005515 protein binding
GO:0005739 mitochondrion
GO:0005741 mitochondrial outer membrane
GO:0006694 steroid biosynthetic process
GO:0006811 ion transport
GO:0006821 chloride transport
GO:0006950 response to stress
GO:0007568 aging
GO:0008347 glial cell migration
GO:0008503 benzodiazepine receptor activity
GO:0010042 response to manganese ion
GO:0010266 response to vitamin B1
GO:0010670 positive regulation of oxygen and reactive oxygen species metabolic process
GO:0010940 positive regulation of necrotic cell death
GO:0014012 axon regeneration in the peripheral nervous system
GO:0016020 membrane
GO:0016021 integral to membrane
GO:0030325 adrenal gland development
GO:0032570 response to progesterone stimulus
GO:0032720 negative regulation of tumor necrosis factor production
GO:0033574 response to testosterone stimulus
GO:0042493 response to drug
GO:0043065 positive regulation of apoptosis
GO:0045019 negative regulation of nitric oxide biosynthetic process
GO:0048265 response to pain
GO:0048266 behavioral response to pain
GO:0048678 response to axon injury
GO:0050810 regulation of steroid biosynthetic process
GO:0051901 positive regulation of mitochondrial depolarization
GO:0051928 positive regulation of calcium ion transport
GO:0060242 contact inhibition
GO:0060252 positive regulation of glial cell proliferation
GO:0060253 negative regulation of glial cell proliferation
GO:0071222 cellular response to lipopolysaccharide
GO:0071294 cellular response to zinc ion
GO:0071476 cellular hypotonic response
InterPro families  IPR004307 TspO/MBR-related protein
Orthology groupMCL13105

Nucleotide sequence:

ATGGTTAACTGGAGTATGATTGGTGCCATGGTGCTGCCAAACTCTGGTGGCTGGCTCGGA
GCTTTGACGATGTCCGGCCAAGTCAGATCTAAGACTGGCGTATCCTGGTATGATACCATA
AAAAAACCAAGTTGGAATCCCCCAAAATGGGTATTTGGCCCGGCCTGGACAGTTCTATAT
ACAGGAATGGGATATGCCTCTTATAAGATTTATGAAGATTGTGGCGGTTTCACTGAGAGA
GCTGTGTTGCCGCTATCTTTATATGGCAGTCAATTACTTTTAAACTGGACTTGGAGTCCG
GTGTTCTTCAAGTATCATAAAATGGGTTGGGCTTTCGTACATATAGTAGCGTTAGACGTA
ATGGCCGCTGCCTGTTCCTACAGCTTCTATAACATCAATCAAACAACTATATATTTAATG
TCGCCATATCTAGCTTGGCTCAGTTTCGCGTCTTTCCTCAACTACACTATATGGAAGATG
AACAACGATGACAAAGGCAATATTAAACCTCTATAA

Protein sequence:

MVNWSMIGAMVLPNSGGWLGALTMSGQVRSKTGVSWYDTIKKPSWNPPKWVFGPAWTVLY
TGMGYASYKIYEDCGGFTERAVLPLSLYGSQLLLNWTWSPVFFKYHKMGWAFVHIVALDV
MAAACSYSFYNINQTTIYLMSPYLAWLSFASFLNYTIWKMNNDDKGNIKPL