New model in OGS2.0 | DPOGS201707  |
---|---|
Genomic Position | scaffold448:- 43679-44607 |
See gene structure | |
CDS Length | 516 |
Paired RNAseq reads   | 248 |
Single RNAseq reads   | 867 |
Migratory profiles | Query via corresponding ESTs |
Best Bmobyx hit | BGIBMGA010792 (9e-47) |
Best Drosophila hit   | CG2789 (3e-28) |
Best Human hit | translocator protein isoform PBR (1e-28) |
Best NR hit (blastp)   | peripheral-type benzodiazepine receptor [Bombyx mori] (2e-47) |
Best NR hit (blastx)   | peripheral-type benzodiazepine receptor [Bombyx mori] (1e-44) |
GeneOntology terms    | GO:0004872 receptor activity GO:0005497 androgen binding GO:0005515 protein binding GO:0005739 mitochondrion GO:0005741 mitochondrial outer membrane GO:0006694 steroid biosynthetic process GO:0006811 ion transport GO:0006821 chloride transport GO:0006950 response to stress GO:0007568 aging GO:0008347 glial cell migration GO:0008503 benzodiazepine receptor activity GO:0010042 response to manganese ion GO:0010266 response to vitamin B1 GO:0010670 positive regulation of oxygen and reactive oxygen species metabolic process GO:0010940 positive regulation of necrotic cell death GO:0014012 axon regeneration in the peripheral nervous system GO:0016020 membrane GO:0016021 integral to membrane GO:0030325 adrenal gland development GO:0032570 response to progesterone stimulus GO:0032720 negative regulation of tumor necrosis factor production GO:0033574 response to testosterone stimulus GO:0042493 response to drug GO:0043065 positive regulation of apoptosis GO:0045019 negative regulation of nitric oxide biosynthetic process GO:0048265 response to pain GO:0048266 behavioral response to pain GO:0048678 response to axon injury GO:0050810 regulation of steroid biosynthetic process GO:0051901 positive regulation of mitochondrial depolarization GO:0051928 positive regulation of calcium ion transport GO:0060242 contact inhibition GO:0060252 positive regulation of glial cell proliferation GO:0060253 negative regulation of glial cell proliferation GO:0071222 cellular response to lipopolysaccharide GO:0071294 cellular response to zinc ion GO:0071476 cellular hypotonic response |
InterPro families   | IPR004307 TspO/MBR-related protein |
Orthology group | MCL13105 |
Nucleotide sequence:
ATGGTTAACTGGAGTATGATTGGTGCCATGGTGCTGCCAAACTCTGGTGGCTGGCTCGGA
GCTTTGACGATGTCCGGCCAAGTCAGATCTAAGACTGGCGTATCCTGGTATGATACCATA
AAAAAACCAAGTTGGAATCCCCCAAAATGGGTATTTGGCCCGGCCTGGACAGTTCTATAT
ACAGGAATGGGATATGCCTCTTATAAGATTTATGAAGATTGTGGCGGTTTCACTGAGAGA
GCTGTGTTGCCGCTATCTTTATATGGCAGTCAATTACTTTTAAACTGGACTTGGAGTCCG
GTGTTCTTCAAGTATCATAAAATGGGTTGGGCTTTCGTACATATAGTAGCGTTAGACGTA
ATGGCCGCTGCCTGTTCCTACAGCTTCTATAACATCAATCAAACAACTATATATTTAATG
TCGCCATATCTAGCTTGGCTCAGTTTCGCGTCTTTCCTCAACTACACTATATGGAAGATG
AACAACGATGACAAAGGCAATATTAAACCTCTATAA
Protein sequence:
MVNWSMIGAMVLPNSGGWLGALTMSGQVRSKTGVSWYDTIKKPSWNPPKWVFGPAWTVLY
TGMGYASYKIYEDCGGFTERAVLPLSLYGSQLLLNWTWSPVFFKYHKMGWAFVHIVALDV
MAAACSYSFYNINQTTIYLMSPYLAWLSFASFLNYTIWKMNNDDKGNIKPL