DPGLEAN10033 in OGS1.0

New model in OGS2.0DPOGS203345 
Genomic Positionscaffold1196:- 68941-75231
See gene structure
CDS Length2001
Paired RNAseq reads  3074
Single RNAseq reads  6752
Migratory profilesQuery via corresponding ESTs
Best Bmobyx hitBGIBMGA011993 (3e-160)
Best Drosophila hit  CG2017, isoform E (3e-110)
Best Human hitGTP-binding protein 2 (1e-88)
Best NR hit (blastp)  GTP-binding protein, putative [Pediculus humanus corporis] (3e-126)
Best NR hit (blastx)  GTP-binding protein, putative [Pediculus humanus corporis] (1e-110)
GeneOntology terms
  
GO:0005525 GTP binding
GO:0003924 GTPase activity
InterPro families

  
IPR009001 Translation elongation factor EF1A/initiation factor IF2gamma, C-terminal
IPR009000 Translation elongation/initiation factor/Ribosomal, beta-barrel
IPR000795 Protein synthesis factor, GTP-binding
Orthology groupMCL13566

Nucleotide sequence:

ATGTACCTGGCCGGCGACCTGAGCGCGGAGGACCTTGAGAGCGACTTCTTTTACAGTTCA
GACGACATGGACGACTTCTGTGACGATACAACCTCGGAGGCGTCTGACTCTGGCGAGGAA
TGCTACGGCAGTCTTCCCCCAGAACCTCGTTTCGGTAACGTTGAGTACAAACTGCAGCTG
GTGTCGCCTTGCGAGAGAAGATTCCAGCATTTGGTTACACAGCTGAAATGGCGTCTCCGC
TCTGGCGGTGGGAGCGCGGTGTACGTGGTAGGGGTCCGGGATAATGGAGCGCTAGTAGGG
CTCCATGCGGGTGCGCTCCGAGCCTCGCTGTGCTCGTTGAGGGACATGGCGAGAGCTCTG
GGAGCTGTGATCGTTAGCGCGCGCGCGAGACGAGTGACCAGTAGCCGGGCTGTCGCTGAG
GTTTATATACGGAAGTTAGCGGACACTCAACAAAGTGTGGAACTGCGTGTGGCTGTGATG
GGGGCTATAGAAGCTGGGAAATCTACCCTCATTGGGGTCCTAACACAAGGTGAATTAGAT
AATGGCAGAGGCAGCGCTCGTCTGAATATGTTCAGACATCTCCATGAAGTCAGAAGCGGA
AGGACGTCTTCGCTCAGCCACGAGATACTCGGGTTCGACTCTCAGGGTAACGTGGTGAAT
TATGGCTGTTCTGAGCTGATGACGGCGGAGCGTATCGGAGAGAGGAGTTCCAAGCTGGTG
TCTTTCTTAGACCTCGCGGGACACAGCAAGTATCAGCGGACCACGGTGTACGGTCTCACG
GGATACTCGCCGCATTACGCCATGATAGTGATATCAGCAACGGCTGGGATAACACCGATA
ACAGAAGAACACATAGGTCTACTTCTTGCCCTGGAACTGCCTTTTTTCGCTGTTATTAAT
AAGACGGAGCTAGCTTCCAGCACTAAGGAGCTGGTGGATAGGCTCGGAGAAATACTTTCG
ACGGCGAACAAGAAACCTCTTCTCATAACGGACGAGAACCTCGCGAGGAATTGTATAGCG
CCGTCCATATTGGACTCCATTGATAATGAGGATAAGGAAAATGAAGGATCCTTCATACCT
GTGTTCCCTGTTAGCTGTGTTCGTGGAGTTGGTCTCAACTCATTGCACGCGTACCTCCTC
GCTCTCAGACCACCCGCTGGCGGCGTAGAGACTACAAGGGAAGATGAGACCTGCGAGTTC
CAAATAGACGAGATCTTCCACGTGGCGTCCGGGGCTCCGGTCGTTGGAGGTCTCCTGGCT
CGGGGGGCGCTCAACGAGGGCGACACGCTGTTAGTGGGTCCATTAGACAGCGGTCAATTC
GTCAAAACGACTGTGTTATCCATATATCGTAATCGGGTTCCTTGCGCGTCCGTCCGCGCC
GGACAGTCTGCCTCGCTGGGGCTCCGCCCCGGGCCAGTTCTGAGGCCCGGTATGGTGCTC
CTCGCTATACCAGAAGACTATGGCACGGGGGCCCGGCCCGCTTTCGGCGGCTGTGGGGGA
CTACGGTGCGGGGGGAGGGAGATATCGGAACTTGTGAAATCGTCGCAGGAGAAGAACCGA
AAGAACGCGAGGCGCAACAAGAACATTAAGGAGATCAACATAACGGACAAACATACAGAC
AAACTCACAGACGCTTTGGGGGACGGAGACTGCGTGTGCAGCGACGTGGTACCACTAGAA
GACCCGAACGACCCAAGAGGTTGTATTTACTTCCAGGCTAGCGTCCACCTCCTCCGACAC
TCCACCTCCATATCTCCAGGGTTCCAGTGTTCCGTACACGTGGGGAACGTGAGGCAGACA
GCCATCATAGAGGGTATACTGTCAGCGATGTCTTCGCTCCGGCCCGGTCAGAGCGCGTGC
GTGTTGTTCAGGTTTGCGCGCTGTCCGGAGTATTTGAGGAAGGGCAGGAGGCTGCTGTTC
ACCGCCGGACTTGGGACCAGAGCCATCGGAGTCGTGACGCAGACGTTCCCGTACATACCG
CAGCCGAAAGATAATTTATAA

Protein sequence:

MYLAGDLSAEDLESDFFYSSDDMDDFCDDTTSEASDSGEECYGSLPPEPRFGNVEYKLQL
VSPCERRFQHLVTQLKWRLRSGGGSAVYVVGVRDNGALVGLHAGALRASLCSLRDMARAL
GAVIVSARARRVTSSRAVAEVYIRKLADTQQSVELRVAVMGAIEAGKSTLIGVLTQGELD
NGRGSARLNMFRHLHEVRSGRTSSLSHEILGFDSQGNVVNYGCSELMTAERIGERSSKLV
SFLDLAGHSKYQRTTVYGLTGYSPHYAMIVISATAGITPITEEHIGLLLALELPFFAVIN
KTELASSTKELVDRLGEILSTANKKPLLITDENLARNCIAPSILDSIDNEDKENEGSFIP
VFPVSCVRGVGLNSLHAYLLALRPPAGGVETTREDETCEFQIDEIFHVASGAPVVGGLLA
RGALNEGDTLLVGPLDSGQFVKTTVLSIYRNRVPCASVRAGQSASLGLRPGPVLRPGMVL
LAIPEDYGTGARPAFGGCGGLRCGGREISELVKSSQEKNRKNARRNKNIKEINITDKHTD
KLTDALGDGDCVCSDVVPLEDPNDPRGCIYFQASVHLLRHSTSISPGFQCSVHVGNVRQT
AIIEGILSAMSSLRPGQSACVLFRFARCPEYLRKGRRLLFTAGLGTRAIGVVTQTFPYIP
QPKDNL