| New model in OGS2.0 | DPOGS215544 |
|---|---|
| Genomic Position | scaffold7237:+ 4062-4223 |
| See gene structure | |
| CDS Length | 162 |
| Paired RNAseq reads | 1 |
| Single RNAseq reads | 90 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA002299 (6e-21) |
| Best Drosophila hit | CG6051 (8e-11) |
| Best Human hit | lateral signaling target protein 2 homolog isoform 4 (5e-12) |
| Best NR hit (blastp) | PREDICTED: similar to CG6051 CG6051-PB [Tribolium castaneum] (7e-15) |
| Best NR hit (blastx) | PREDICTED: similar to CG6051-PA, partial [Apis mellifera] (1e-14) |
| GeneOntology terms | GO:0005829 cytosol GO:0007175 negative regulation of epidermal growth factor receptor activity GO:0031901 early endosome membrane GO:0032266 phosphatidylinositol-3-phosphate binding GO:0042059 negative regulation of epidermal growth factor receptor signaling pathway |
| InterPro families | ND |
| Orthology group | MCL39654 |
Nucleotide sequence:
AGGGATGACGGTTCTCTACTAGCGCAGTTCTTCTTCGCTGATGACGCGCTTAATATGATA
GCTGCTGAGTTGGACTCTTTCGATGGTCGAAAGGACCCAGAGAGGTGTTCGACACTCGTG
AACCAACTACGTCATGCACAGGTTTGTCAACAAATACACTAA
Protein sequence:
RDDGSLLAQFFFADDALNMIAAELDSFDGRKDPERCSTLVNQLRHAQVCQQIH