| New model in OGS2.0 | DPOGS204168 |
|---|---|
| Genomic Position | scaffold277:+ 107822-118081 |
| See gene structure | |
| CDS Length | 462 |
| Paired RNAseq reads | 56 |
| Single RNAseq reads | 232 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA005085 (3e-50) |
| Best Drosophila hit | prospero, isoform E (2e-83) |
| Best Human hit | prospero homeobox protein 1 (2e-52) |
| Best NR hit (blastp) | AGAP004052-PA [Anopheles gambiae str. PEST] (5e-87) |
| Best NR hit (blastx) | AGAP004052-PA [Anopheles gambiae str. PEST] (3e-81) |
| GeneOntology terms | GO:0007417 central nervous system development GO:0007422 peripheral nervous system development GO:0005634 nucleus GO:0045664 regulation of neuron differentiation GO:0003700 sequence-specific DNA binding transcription factor activity GO:0045179 apical cortex GO:0045180 basal cortex GO:0048813 dendrite morphogenesis GO:0030528 transcription regulator activity GO:0006355 regulation of transcription, DNA-dependent GO:0007409 axonogenesis GO:0007399 nervous system development GO:0050909 sensory perception of taste GO:0010001 glial cell differentiation GO:0005938 cell cortex GO:0008356 asymmetric cell division GO:0007400 neuroblast fate determination GO:0007402 ganglion mother cell fate determination GO:0007465 R7 cell fate commitment GO:0042676 compound eye cone cell fate commitment GO:0007619 courtship behavior GO:0007416 synapse assembly GO:0045178 basal part of cell GO:0007423 sensory organ development GO:0007419 ventral cord development GO:0016566 specific transcriptional repressor activity GO:0003677 DNA binding GO:0001708 cell fate specification GO:0001754 eye photoreceptor cell differentiation GO:0045449 regulation of transcription GO:0007405 neuroblast proliferation GO:0007406 negative regulation of neuroblast proliferation GO:0055060 asymmetric neuroblast division resulting in ganglion mother cell formation GO:0006911 phagocytosis, engulfment GO:0008285 negative regulation of cell proliferation GO:0007420 brain development GO:0005886 plasma membrane GO:0005875 microtubule associated complex GO:0007411 axon guidance GO:0060385 axonogenesis involved in innervation |
| InterPro families | IPR007738 Prospero homeobox protein 1 IPR023082 Homeo-prospero domain IPR009057 Homeodomain-like |
| Orthology group | MCL11053 |
Nucleotide sequence:
ATGCACCTACGCAAGGCTAAGTTGATGTTCTTCTGGGTCCGGTATCCGAGCTCCGCGGTG
CTGAAGATGTACTTCCCAGATATCAAGTTCAACAAGAACAACACAGCACAGCTCGTCAAA
TGGTTCTCTAACTTCAGAGAATTCTACTACATCCAAATGGAGAAGTACGCGCGGCAAGCC
ATCAGCGAAGGTTTGAAGACGGCGGACGATCTCCACGTGGCTGGCGACTCCGAGCTGTAT
AGAGTGCTCAATCTGCATTATAACAGAAATAATCATATTGAAGTTCCACCCAACTTCCGA
TACGTTGTGGAGCAGACGTTACGCGAGTTCTTCCGCGCCATCCAGGGCGGGAAGGACGCG
GAACAGAGCTGGAAGAAGTCCATCTACAAGGTGATATCTCGCCTGGACGACCCCGTGCCC
GAGTACTTCAAGTCGCCCAACTTCTTGGAACAGCTGGAGTGA
Protein sequence:
MHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQA
ISEGLKTADDLHVAGDSELYRVLNLHYNRNNHIEVPPNFRYVVEQTLREFFRAIQGGKDA
EQSWKKSIYKVISRLDDPVPEYFKSPNFLEQLE