DPGLEAN10196 in OGS1.0

New model in OGS2.0DPOGS214060 
Genomic Positionscaffold4242:- 1336-2203
See gene structure
CDS Length663
Paired RNAseq reads  94
Single RNAseq reads  286
Migratory profilesQuery via corresponding ESTs
Best Bmobyx hitBGIBMGA010397 (2e-98)
Best Drosophila hit  CG9304 (3e-48)
Best Human hitND
Best NR hit (blastp)  PREDICTED: similar to AGAP011701-PA [Tribolium castaneum] (4e-70)
Best NR hit (blastx)  PREDICTED: similar to AGAP011701-PA [Tribolium castaneum] (1e-70)
GeneOntology terms  GO:0016021 integral to membrane
InterPro families  IPR019336 Rhodopsin-like GPCR transmembrane domain
Orthology groupMCL16523

Nucleotide sequence:

ATGTTTCAACATTTAAATGGTTCAGCATACCATCCAAAGTGCAATGCATTAGGTCAGGAC
TTATTTCGAAGGATACCATGTCCGATAGGCAAACTATGCGTTGATGAGGATACACCATGG
AATGTTATTAAAAACAACCAATTTACTTATGTCATACAAAATAACGGGCAACCAAGATAT
TGGTATGTGTCGATAGTATCTTGTTATTTGGATGAAGAAACGTGTTCCTGGCATCATTAC
TCTGGAGCTCCGTCAAAGGACAACACAACTCTCACAGATATCCCACAAACTCTAGAATAT
GATTTCTGGCTTGTTAACGGAAGCCCGAATCTGTCAATTTATAATTCTATGTTATATCAG
TTTTCGTTTGACAGACAGAATACTTTGGAATTATATTTAATGTTCTGGCTCTGCTATATC
ATTTTATTACCCGTTCAGATATATGCTGTGAGAACTCAGAGACATCCTGTTACTAAATTA
TTTACATCAAGCTTGGTGTTAGAGTTCATAGCTCTGTGTTTTAATGTACTTCACACAGTG
AAATTTGCTGCGGACGGTGAAGGCTTTGAAGGCCTGTCTGTCGCTGGTGATATTCTCGAT
ATACTGAGTAGGGTAAGATCATTTAATGTAATAGATACAAGTCTTGTTTTTCCAGTGAAG
TAA

Protein sequence:

MFQHLNGSAYHPKCNALGQDLFRRIPCPIGKLCVDEDTPWNVIKNNQFTYVIQNNGQPRY
WYVSIVSCYLDEETCSWHHYSGAPSKDNTTLTDIPQTLEYDFWLVNGSPNLSIYNSMLYQ
FSFDRQNTLELYLMFWLCYIILLPVQIYAVRTQRHPVTKLFTSSLVLEFIALCFNVLHTV
KFAADGEGFEGLSVAGDILDILSRVRSFNVIDTSLVFPVK