New model in OGS2.0 | DPOGS212371  |
---|---|
Genomic Position | scaffold101:+ 284727-285126 |
See gene structure | |
CDS Length | 321 |
Paired RNAseq reads   | 51 |
Single RNAseq reads   | 476 |
Migratory profiles | Query via corresponding ESTs |
Best Bmobyx hit | BGIBMGA000148 (6e-48) |
Best Drosophila hit   | longitudinals lacking, isoform G (4e-13) |
Best Human hit | ND |
Best NR hit (blastp)   | lola [Aedes aegypti] (1e-12) |
Best NR hit (blastx)   | lola [Aedes aegypti] (4e-12) |
GeneOntology terms    | GO:0003704 specific RNA polymerase II transcription factor activity GO:0007409 axonogenesis GO:0005634 nucleus GO:0016563 transcription activator activity GO:0045893 positive regulation of transcription, DNA-dependent GO:0007411 axon guidance GO:0006357 regulation of transcription from RNA polymerase II promoter GO:0003702 RNA polymerase II transcription factor activity GO:0016199 axon midline choice point recognition GO:0005515 protein binding GO:0008270 zinc ion binding GO:0019730 antimicrobial humoral response GO:0045476 nurse cell apoptosis GO:0032583 regulation of gene-specific transcription GO:0045467 R7 cell development GO:0007464 R3/R4 cell fate commitment GO:0048854 brain morphogenesis GO:0031987 locomotion involved in locomotory behavior GO:0001964 startle response GO:0002121 inter-male aggressive behavior |
InterPro families    | IPR015880 Zinc finger, C2H2-like IPR007087 Zinc finger, C2H2-type |
Orthology group | MCL20482 |
Nucleotide sequence:
ATGGTGCATTATCCTATGCTTGAGTCGAGGGCGACACTTTCTCGAGTTGCACAGTTGTAC
ACGCCTTATATTTTGGGTTACGGGACGCCGGGCCTCAGCGGGGGTAAGGCCGGTTGGACT
CTGTACGAGTGTGTCGACTGCGGCAACAAATACAAGCACAAAGGCTCGCTACAGCGACAC
ATTAAGTACGAGTGTAGGAAGCAACCGAGTTTCAAGTGTCCGTACTGTGTGTACCGCGCG
TACCAGAAACACAACTTACTCCTCCACGAGCGTCATCTCCATAAAGACTTGCCAGAAAAA
GTGGACTTCGTGTCCGAATGA
Protein sequence:
MVHYPMLESRATLSRVAQLYTPYILGYGTPGLSGGKAGWTLYECVDCGNKYKHKGSLQRH
IKYECRKQPSFKCPYCVYRAYQKHNLLLHERHLHKDLPEKVDFVSE