New model in OGS2.0 | DPOGS207647  |
---|---|
Genomic Position | scaffold713:- 49490-51275 |
See gene structure | |
CDS Length | 231 |
Paired RNAseq reads   | 1 |
Single RNAseq reads   | 343 |
Migratory profiles | Query via corresponding ESTs |
Best Bmobyx hit | BGIBMGA010430 (7e-35) |
Best Drosophila hit   | arrest, isoform B (3e-27) |
Best Human hit | CUGBP Elav-like family member 2 isoform 4 (2e-20) |
Best NR hit (blastp)   | hypothetical protein TcasGA2_TC012080 [Tribolium castaneum] (8e-31) |
Best NR hit (blastx)   | hypothetical protein TcasGA2_TC012080 [Tribolium castaneum] (7e-29) |
GeneOntology terms    | GO:0048477 oogenesis GO:0007286 spermatid development GO:0003729 mRNA binding GO:0007319 negative regulation of oskar mRNA translation GO:0003730 mRNA 3'-UTR binding GO:0005515 protein binding GO:0006378 mRNA polyadenylation GO:0030727 germarium-derived female germ-line cyst formation GO:0042078 germ-line stem cell division GO:0046011 regulation of oskar mRNA translation GO:0017148 negative regulation of translation GO:0000166 nucleotide binding GO:0043186 P granule GO:0005634 nucleus GO:0000381 regulation of alternative nuclear mRNA splicing, via spliceosome GO:0003723 RNA binding GO:0007281 germ cell development GO:0031536 positive regulation of exit from mitosis GO:0002121 inter-male aggressive behavior |
InterPro families    | IPR000504 RNA recognition motif domain IPR012677 Nucleotide-binding, alpha-beta plait |
Orthology group | MCL18977 |
Nucleotide sequence:
ATGTTCGTCGGTCAAGTGCCTAGAAGTATGGACGAAAACGATCTCCGGCTGATGTTTGAA
GAGTTTGGGAGGGTCCATCAGATCAATGTGCTAAGAGATAAGATCACGGGAGCAAGTAAA
GGGTGCTGTTTTGTGACGTTTTTCACGAGGAAAGCGGCGTTGAAAGCTCAGGACGCTTTG
CACAATATCAAAACGTTGAGCGGGGTAAGTGCGTTTAATGTTATATGTTAG
Protein sequence:
MFVGQVPRSMDENDLRLMFEEFGRVHQINVLRDKITGASKGCCFVTFFTRKAALKAQDAL
HNIKTLSGVSAFNVIC