DPGLEAN10710 in OGS1.0

New model in OGS2.0DPOGS200172 
Genomic Positionscaffold328:- 70702-73682
See gene structure
CDS Length426
Paired RNAseq reads  65
Single RNAseq reads  226
Migratory profilesQuery via corresponding ESTs
Best Bmobyx hitBGIBMGA002921 (3e-60)
Best Drosophila hit  Pi3K92E, isoform B (5e-51)
Best Human hitphosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform (6e-42)
Best NR hit (blastp)  AGAP000018-PA [Anopheles gambiae str. PEST] (8e-54)
Best NR hit (blastx)  Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform, putative [Pediculus humanus corporis] (2e-52)
GeneOntology terms


































  
GO:0046934 phosphatidylinositol-4,5-bisphosphate 3-kinase activity
GO:0035004 phosphoinositide 3-kinase activity
GO:0045572 positive regulation of imaginal disc growth
GO:0005943 1-phosphatidylinositol-4-phosphate 3-kinase, class IA complex
GO:0046854 phosphoinositide phosphorylation
GO:0046622 positive regulation of organ growth
GO:0016303 1-phosphatidylinositol-3-kinase activity
GO:0035005 phosphatidylinositol-4-phosphate 3-kinase activity
GO:0042127 regulation of cell proliferation
GO:0008361 regulation of cell size
GO:0045793 positive regulation of cell size
GO:0045927 positive regulation of growth
GO:0016310 phosphorylation
GO:0046620 regulation of organ growth
GO:0030307 positive regulation of cell growth
GO:0008286 insulin receptor signaling pathway
GO:0016049 cell growth
GO:0040014 regulation of multicellular organism growth
GO:0005488 binding
GO:0048015 phosphoinositide-mediated signaling
GO:0006914 autophagy
GO:0007436 larval salivary gland morphogenesis
GO:0030536 larval feeding behavior
GO:0002168 instar larval development
GO:0007552 metamorphosis
GO:0002164 larval development
GO:0006979 response to oxidative stress
GO:0055115 diapause
GO:0060074 synapse maturation
GO:0048169 regulation of long-term neuronal synaptic plasticity
GO:0048813 dendrite morphogenesis
GO:0048477 oogenesis
GO:0001727 lipid kinase activity
GO:0007390 germ-band shortening
GO:0045727 positive regulation of translation
GO:0050773 regulation of dendrite development
InterPro families

  
IPR011009 Protein kinase-like domain
IPR015433 Phosphatidylinositol Kinase
IPR000403 Phosphatidylinositol 3-/4-kinase, catalytic
Orthology groupND

Nucleotide sequence:

ATGCTTAAATTGTTCCACATCGACTTCGGTCACTTCTTGGGCCACTTCAAGCAGAAGTAC
GGGTTCAAACGTGAGCGGGTCCCGTTCGTGTTGACCCACGACTTCATACACGTCATCAAC
AAGGGCCAAAGGGGCGGAGTTCACGACATAGACTTCAAGAGGTTCAGGGAGCTCTGCGAG
ACGGCCTTCATAATCCTTCGGTCTCACGGTCACCTGATCCTGTCCTTGTTCTCAATGATG
ATCAGCACCGGTCTGCCGGAACTCAGCTCGGAGAAGGATCTGCAATACCTCAGGGAGACT
CTGGTGATGGATCTATCTAAGGAGAAGGCTATGGAACACTTCCGCCTGAAGTTCGACGAG
GCGGTGAAGAACTCCTGGACGGCCTCCTTCAACTGGGCCCTTCACAACTTTGACAAGAAC
AACTGA

Protein sequence:

MLKLFHIDFGHFLGHFKQKYGFKRERVPFVLTHDFIHVINKGQRGGVHDIDFKRFRELCE
TAFIILRSHGHLILSLFSMMISTGLPELSSEKDLQYLRETLVMDLSKEKAMEHFRLKFDE
AVKNSWTASFNWALHNFDKNN