DPGLEAN10994 in OGS1.0

New model in OGS2.0DPOGS203438 
Genomic Positionscaffold244:- 17797-25595
See gene structure
CDS Length2283
Paired RNAseq reads  976
Single RNAseq reads  2373
Migratory profilesQuery via corresponding ESTs
Best Bmobyx hitBGIBMGA011251 (2e-36)
Best Drosophila hit  ND
Best Human hitSID1 transmembrane family member 1 precursor (2e-44)
Best NR hit (blastp)  sid-1-related gene1 [Bombyx mori] (0.0)
Best NR hit (blastx)  sid-1-related gene1 [Bombyx mori] (5e-161)
GeneOntology terms
  
GO:0016020 membrane
GO:0016021 integral to membrane
InterPro families  ND
Orthology groupMCL15159

Nucleotide sequence:

ATGGAATTCAATTATAAATTTAAAATAATTGTCTCAATATTTATTTCATGTGCTGTAATA
AAATCTGGAGCCTCATTTAGTGATATCTCACCGTTACAGAACGGGACCCAAAAGAATTTT
GTATACAATAATACGTTTATGTATGACCAGACAATTGATGTGATACTCAATGATACAACC
ACACACATCCTGGACTTCGTTGAGAAGTCACCTGAGTTGTCGGTGTATCCGACGAGAGTG
CAAGTTAGTTCGAATGACTCCTTGACACCCGAGTATCCGGTGTTTGTGACGGCCGCACAG
CAGAAAGGTGTATCTTCCTGGGAGCTGCCTCTCATTGTGTCCACTAGTCACGCAACTCTT
CACTTTGACGAGATGGCGCGGACACTGTGCCCACATGATTCAGGACCCAATATAACGTCA
CAAAGCCGACCGACCCTGACGCTGTCCACGTCGAGTCCGAAGAACTTGTCAGTCAGGATC
GAGTTACGACGAGTCCACGACTTCTACTTGGAAGTCAACAAGGAAGTCAACTTCAGCGTC
ACTCCCAGTACACCAAATTATTATTACTTCTCATTCGACCGGGATCCTCTAAACCTGACT
CATGGCCAGCACTCGCTACGTTTTCCCAGATTTAACTATACGATACCAAAGAGCGTGTTA
CTGATGATAGATTCGGAGGACGATGTCTGCGCCGTCGTCTCTATACAGAATAATTCTTGT
CCCGTGTTCGACAACGAAGAGGACGTTCAGTATCAGGGCTACCACTTCACTATGACGACG
CGCGGCGGGATCACAGTTACCCAATCCATGTTCCCGCGAGGTTTCTACGTAGTGTTCATA
GTGAAGGAGAGCGATGAGGAGTGTACAGGAGTACCTGACAACGTCCACGCTGATAAGAGA
ATCAAGAGATTTAGCTTCATGTATCGTGGTGTCAAACCACCATCTCCAACTTATCACACG
GTATGTACCAACAGATTGGTAGCCGTGCCGTCAGTGTCCTACTCTGATTATGTAACAGGA
GCTCTGGCTGCGCTGGCGCTGGTGATGCTGGTCGCTCTGCTGGCACCTGTCGCCACCGCC
CTCTCGTGTCGCAGCAGTGAAGTATTAATAATAGAAGACCCACTGCCTTCCGGGTCCAGG
TCCGACACCACCGCCAGCGAGACGGCGCCGATGTTTAATAGAAGTGATGAATCTGATCTA
GAGTCTGAGCCTGAGGTGGAGGTCGAGGCGTCTTTGCCTGTGCCGCTCACCCTGGCCGGG
CTCAGTCGGGCGAAGCCTGTAGCACATGACAGGCGATCCAACAGGTACTTCTGGAGCGCG
TTGACGGTAGCGGTGGTACCGGTGACCAGGACGTGTGCTACCGGGGGGGCGGGGAGGGAG
GCGCTCGGTATACCGCAACACCGCGGCCTATTATACTCGATGGCGTTGGCGCTCTTCATG
GAGGGACTCCTCTCCGCCTGCTACCATCTATGCCCCAATAAGATGAACTTCCAGTTCGAC
TCGTCGTTCATGTACGTGATAGCTGTTCTGTGCATCGTGAAGCTGTACCAGTCGCGGCAC
CCGGATGTGAACGCCAGCGCGCACACCACTTTCATGCTGATAGCGTGTCTGATGGCTATA
GGTCTGTTGGGTATCATGTACCCGAGCCTGTACTTCTGGTGGCTGTTCACTGTGCTGCAC
CTCGCCGCCTGCTTCTTCCTAACACTCAATATATATTACGTCGGCAAGTTGAAGATGGAT
CGCTCGCTGCCGTATCAGGCTTGGTCGGGTCTGAGGACTCACGGCTGGTCGTCGTTTAGG
GTGAAGTATCCTGCGCGGGCGGCTCTCATAGCTGTGGCGAATGTGGCCAACTGGGCGCTC
GCGGGATACGGGCTGTACGAGCACAACAAGGACTTCGCGCGCCACCTGCTGGCGATCCTG
ATGGGGAACGCGATCCTGTACACGCTGGGCTACGTGTTCATGAAGCTGCTGCACCGGGAG
ACGGTCCCGCTGGCCGCCTGGCTGTGGCTGGGCGCGGCGCACCTCACGTGGGCGGGCGCG
GCGGTGTTGTTCCTGTCCTCGAGGACCAAGTGGTCGGTGAGTTCAACCTGTCCTTCCTCT
CTCCAGCAAACCGCGGCCCAGTCCCGCACCCACAACGCCGTGTGCTCGTCTCTGCGCGTG
TTCGACGAGCACGATCTGTGGCACCTGTCGTCGGCGGCCGCGGTGTTCTTCTCCTTCAAC
GTGCTGCTGGTGCTGGACACGCCGCTCGACAACACTCCCAGACACCTCATACCCAGCTTC
TAG

Protein sequence:

MEFNYKFKIIVSIFISCAVIKSGASFSDISPLQNGTQKNFVYNNTFMYDQTIDVILNDTT
THILDFVEKSPELSVYPTRVQVSSNDSLTPEYPVFVTAAQQKGVSSWELPLIVSTSHATL
HFDEMARTLCPHDSGPNITSQSRPTLTLSTSSPKNLSVRIELRRVHDFYLEVNKEVNFSV
TPSTPNYYYFSFDRDPLNLTHGQHSLRFPRFNYTIPKSVLLMIDSEDDVCAVVSIQNNSC
PVFDNEEDVQYQGYHFTMTTRGGITVTQSMFPRGFYVVFIVKESDEECTGVPDNVHADKR
IKRFSFMYRGVKPPSPTYHTVCTNRLVAVPSVSYSDYVTGALAALALVMLVALLAPVATA
LSCRSSEVLIIEDPLPSGSRSDTTASETAPMFNRSDESDLESEPEVEVEASLPVPLTLAG
LSRAKPVAHDRRSNRYFWSALTVAVVPVTRTCATGGAGREALGIPQHRGLLYSMALALFM
EGLLSACYHLCPNKMNFQFDSSFMYVIAVLCIVKLYQSRHPDVNASAHTTFMLIACLMAI
GLLGIMYPSLYFWWLFTVLHLAACFFLTLNIYYVGKLKMDRSLPYQAWSGLRTHGWSSFR
VKYPARAALIAVANVANWALAGYGLYEHNKDFARHLLAILMGNAILYTLGYVFMKLLHRE
TVPLAAWLWLGAAHLTWAGAAVLFLSSRTKWSVSSTCPSSLQQTAAQSRTHNAVCSSLRV
FDEHDLWHLSSAAAVFFSFNVLLVLDTPLDNTPRHLIPSF