New model in OGS2.0 | DPOGS208399  |
---|---|
Genomic Position | scaffold1444:- 87220-89526 |
See gene structure | |
CDS Length | 231 |
Paired RNAseq reads   | 31 |
Single RNAseq reads   | 1405 |
Migratory profiles | Query via corresponding ESTs |
Best Bmobyx hit | BGIBMGA004046 (1e-13) |
Best Drosophila hit   | pherokine 3 (1e-10) |
Best Human hit | ND |
Best NR hit (blastp)   | chemosensory protein [Papilio xuthus] (6e-24) |
Best NR hit (blastx)   | chemosensory protein [Papilio xuthus] (1e-14) |
GeneOntology terms    | GO:0048477 oogenesis GO:0004674 protein serine/threonine kinase activity GO:0007362 terminal region determination GO:0007165 signal transduction GO:0005737 cytoplasm GO:0019897 extrinsic to plasma membrane GO:0019992 diacylglycerol binding GO:0007369 gastrulation GO:0008595 anterior/posterior axis specification, embryo GO:0008293 torso signaling pathway GO:0030707 ovarian follicle cell development GO:0007265 Ras protein signal transduction GO:0007283 spermatogenesis GO:0004672 protein kinase activity GO:0006468 protein amino acid phosphorylation GO:0007552 metamorphosis GO:0009617 response to bacterium |
InterPro families   | IPR005055 Insect pheromone-binding protein A10/OS-D |
Orthology group | ND |
Nucleotide sequence:
ATGGACCAAGGACGTTGCACTCCTGAGGGTAACACATTGAAAGTACACGTAACGGATGCA
ATTCAAAATTCCTGTTCAAAATGCACAGAAATCCAGAAAACGAAAGCCAGGAAGGTTGTG
AACTACATTCGCGAAAACAACAAAGACGTCTGGGACGAATTGATAAAGAAATATGACCCT
AAAGATGAATATAAAGAAAAATACGAAGCATTTCTTGAAGGCAAATTTTGA
Protein sequence:
MDQGRCTPEGNTLKVHVTDAIQNSCSKCTEIQKTKARKVVNYIRENNKDVWDELIKKYDP
KDEYKEKYEAFLEGKF