New model in OGS2.0 | DPOGS210682  |
---|---|
Genomic Position | scaffold1012:- 53741-54720 |
See gene structure | |
CDS Length | 309 |
Paired RNAseq reads   | 380 |
Single RNAseq reads   | 982 |
Migratory profiles | Query via corresponding ESTs |
Best Bmobyx hit | BGIBMGA001091 (2e-07) |
Best Drosophila hit   | fat-spondin, isoform A (3e-08) |
Best Human hit | amyloid beta A4 protein isoform a precursor (2e-09) |
Best NR hit (blastp)   | amyloid beta A4 protein [Rattus norvegicus] (3e-08) |
Best NR hit (blastx)   | PREDICTED: amyloid beta A4 protein-like isoform 1 [Ailuropoda melanoleuca] (4e-08) |
GeneOntology terms    | GO:0000085 G2 phase of mitotic cell cycle GO:0001967 suckling behavior GO:0003677 DNA binding GO:0004867 serine-type endopeptidase inhibitor activity GO:0005102 receptor binding GO:0005515 protein binding GO:0005576 extracellular region GO:0005624 membrane fraction GO:0005737 cytoplasm GO:0005794 Golgi apparatus GO:0005905 coated pit GO:0006378 mRNA polyadenylation GO:0006417 regulation of translation GO:0006468 protein amino acid phosphorylation GO:0006878 cellular copper ion homeostasis GO:0006897 endocytosis GO:0006917 induction of apoptosis GO:0007155 cell adhesion GO:0007176 regulation of epidermal growth factor receptor activity GO:0007219 Notch signaling pathway GO:0007409 axonogenesis GO:0007617 mating behavior GO:0007626 locomotory behavior GO:0008088 axon cargo transport GO:0008201 heparin binding GO:0008344 adult locomotory behavior GO:0008542 visual learning GO:0009986 cell surface GO:0016020 membrane GO:0016021 integral to membrane GO:0016199 axon midline choice point recognition GO:0016322 neuron remodeling GO:0016358 dendrite development GO:0016504 peptidase activator activity GO:0019717 synaptosome GO:0030198 extracellular matrix organization GO:0030414 peptidase inhibitor activity GO:0030424 axon GO:0030900 forebrain development GO:0031093 platelet alpha granule lumen GO:0031175 neuron projection development GO:0031410 cytoplasmic vesicle GO:0031594 neuromuscular junction GO:0033130 acetylcholine receptor binding GO:0035235 ionotropic glutamate receptor signaling pathway GO:0035253 ciliary rootlet GO:0040014 regulation of multicellular organism growth GO:0042802 identical protein binding GO:0043005 neuron projection GO:0043197 dendritic spine GO:0043198 dendritic shaft GO:0045177 apical part of cell GO:0045202 synapse GO:0045931 positive regulation of mitotic cell cycle GO:0045944 positive regulation of transcription from RNA polymerase II promoter GO:0046872 metal ion binding GO:0048471 perinuclear region of cytoplasm GO:0048669 collateral sprouting in the absence of injury GO:0050803 regulation of synapse structure and activity GO:0050885 neuromuscular process controlling balance GO:0051124 synaptic growth at neuromuscular junction GO:0051233 spindle midzone GO:0051402 neuron apoptosis GO:0051563 smooth endoplasmic reticulum calcium ion homeostasis |
InterPro families   | IPR002223 Proteinase inhibitor I2, Kunitz metazoa |
Orthology group | ND |
Nucleotide sequence:
ATGACGTTCTTATTGTGTGCTGCTGTCTGTTCATTAGCATTATTGTCTGTGACTCATACT
GCCTACGATTATGTAAAATATGGCCGCGAAGATGATGGTCCGTTTCCTTCTAATTTGATA
AATATTCCGTATTATTGTTATCAAGCGCCCTCAAAAGGCCCATGTGACGGTATGTTCAAG
GTATACTTCTTTGACATTGTCAGAAGGCAGTGTATGCCAATGTTCTATTCGGGATGCGGT
GGAAATGAAAACAGATTCACAACAAAAACTTCATGTTTAATACATTGTGGCCGTATGCGT
TCCATTTAG
Protein sequence:
MTFLLCAAVCSLALLSVTHTAYDYVKYGREDDGPFPSNLINIPYYCYQAPSKGPCDGMFK
VYFFDIVRRQCMPMFYSGCGGNENRFTTKTSCLIHCGRMRSI