| New model in OGS2.0 | DPOGS211211 |
|---|---|
| Genomic Position | scaffold81:+ 37376-37963 |
| See gene structure | |
| CDS Length | 213 |
| Paired RNAseq reads | 1 |
| Single RNAseq reads | 176 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA003193 (4e-20) |
| Best Drosophila hit | mind bomb 1 (1e-15) |
| Best Human hit | E3 ubiquitin-protein ligase MIB1 (3e-17) |
| Best NR hit (blastp) | conserved hypothetical protein [Ixodes scapularis] (3e-18) |
| Best NR hit (blastx) | conserved hypothetical protein [Ixodes scapularis] (5e-19) |
| GeneOntology terms | GO:0005737 cytoplasm GO:0016020 membrane GO:0005886 plasma membrane GO:0016874 ligase activity GO:0016567 protein ubiquitination GO:0004842 ubiquitin-protein ligase activity GO:0008270 zinc ion binding GO:0005515 protein binding GO:0007219 Notch signaling pathway GO:0001568 blood vessel development GO:0007507 heart development GO:0046872 metal ion binding GO:0001701 in utero embryonic development GO:0045665 negative regulation of neuron differentiation GO:0045807 positive regulation of endocytosis GO:0001756 somitogenesis GO:0001841 neural tube formation GO:0001947 heart looping GO:0031410 cytoplasmic vesicle GO:0014069 postsynaptic density |
| InterPro families | IPR002110 Ankyrin repeat IPR020683 Ankyrin repeat-containing domain |
| Orthology group | MCL20490 |
Nucleotide sequence:
ATGCACGCTCACAAAAGCGAGACTGCTTGGGCGTCACCGCAGTGGCACGTAGCGCTGGAT
TCCGAGGGCGATACTCCGTTGCATGACGCGATATCGAAGAAGCGTGATGACATATTGACA
TTGTTGTTGGATCACGGCGCTGACATGACTCTCACCAACAACAACGGGTTCAACTCTCTG
CACCACGCCGCCTTGAGATGCAATCCAAGGTAA
Protein sequence:
MHAHKSETAWASPQWHVALDSEGDTPLHDAISKKRDDILTLLLDHGADMTLTNNNGFNSL
HHAALRCNPR