DPGLEAN12377 in OGS1.0

New model in OGS2.0DPOGS214433 
Genomic Positionscaffold410:+ 38690-40198
See gene structure
CDS Length657
Paired RNAseq reads  7
Single RNAseq reads  16
Migratory profilesQuery via corresponding ESTs
Best Bmobyx hitBGIBMGA011352 (4e-43)
Best Drosophila hit  ND
Best Human hitND
Best NR hit (blastp)  conserved hypothetical protein [Culex quinquefasciatus] (1e-27)
Best NR hit (blastx)  AGAP004528-PA [Anopheles gambiae str. PEST] (4e-26)
GeneOntology terms  ND
InterPro families  IPR016181 Acyl-CoA N-acyltransferase
Orthology groupMCL10564

Nucleotide sequence:

ATGGTGTTCCGCCGGCCCGAGTCCCTGCCCCTGCCGTCCACGTGGCGCAGGTTCACCGTA
TGTAACACTAACCTGGTCGTCAGAGACCTCACTGAGGACCTGCGGGAGACGGCTGTCCAG
CTTCTGGTCAAGTACTTCACGGCTCATGAACCGCCGTGCAAATATATCGAAATCAACAAA
CATCCAACAGCTTTGGGGGAATTGGAGAAGTTGTGGAGGAAAACCATAGACGACCAGCTC
TCGATAGTCTGCGTGAAAGAAGACGACCCCACTGACGTCATCGGAGTCAACGTCCTCACG
GTCTCTGACCAAAACGACAAGGAGGAAGAGTTTAAAACGGAGGACAAGATCTGGGCAAAA
CTGTTTGGAGCCGTGGACCTGGTGACGCGAGCCGTGGACGTGTACCAGACCTTCGGCGTG
GAGAGATATCTGACGGCATACGGATTGGTCGTGGATCCGCAATGGAGAGGCTGGGGCATC
GGCAAGGAGATGCTGTTGGCTAGGTGCGATTTATGTGGGGGACAGTTGTATTCACCAAGT
CAGGGTCTGATCACGGGATCTGCGAGAAATAGAATGGAACTTGATAATGACAATAACGAG
GATCTCAAAGATTCATTATACGGGCAAACCCGGGAGCAACGGCTGGTTCTAATATAA

Protein sequence:

MVFRRPESLPLPSTWRRFTVCNTNLVVRDLTEDLRETAVQLLVKYFTAHEPPCKYIEINK
HPTALGELEKLWRKTIDDQLSIVCVKEDDPTDVIGVNVLTVSDQNDKEEEFKTEDKIWAK
LFGAVDLVTRAVDVYQTFGVERYLTAYGLVVDPQWRGWGIGKEMLLARCDLCGGQLYSPS
QGLITGSARNRMELDNDNNEDLKDSLYGQTREQRLVLI