New model in OGS2.0 | DPOGS213947 DPOGS213946  |
---|---|
Genomic Position | scaffold2279:+ 28084-28278 |
See gene structure | |
CDS Length | 195 |
Paired RNAseq reads   | 7 |
Single RNAseq reads   | 335 |
Migratory profiles | Query via corresponding ESTs |
Best Bmobyx hit | BGIBMGA003385 (2e-29) |
Best Drosophila hit   | polo, isoform B (2e-16) |
Best Human hit | serine/threonine-protein kinase PLK1 (2e-14) |
Best NR hit (blastp)   | PREDICTED: similar to Serine/threonine-protein kinase polo [Apis mellifera] (5e-16) |
Best NR hit (blastx)   | PREDICTED: similar to Serine/threonine-protein kinase polo [Apis mellifera] (5e-16) |
GeneOntology terms    | GO:0007140 male meiosis GO:0007067 mitosis GO:0004674 protein serine/threonine kinase activity GO:0004672 protein kinase activity GO:0000910 cytokinesis GO:0007060 male meiosis chromosome segregation GO:0005813 centrosome GO:0005819 spindle GO:0035046 pronuclear migration GO:0007344 pronuclear fusion GO:0007058 spindle assembly involved in female meiosis II GO:0007147 female meiosis II GO:0035044 sperm aster formation GO:0006468 protein amino acid phosphorylation GO:0008104 protein localization GO:0000940 outer kinetochore of condensed chromosome GO:0005737 cytoplasm GO:0007049 cell cycle GO:0005515 protein binding GO:0042801 polo kinase kinase activity GO:0005524 ATP binding GO:0000776 kinetochore GO:0000922 spindle pole GO:0006911 phagocytosis, engulfment GO:0007143 female meiosis GO:0007052 mitotic spindle organization GO:0007406 negative regulation of neuroblast proliferation GO:0030496 midbody |
InterPro families   | IPR000959 POLO box duplicated domain |
Orthology group | ND |
Nucleotide sequence:
ATAAATTTCCAAGATCACACCAAGATAATACTCTGTCCTCTGATGCAAGCCGTCACATAC
ATAGATGTCGAGAAGAACTTCAGAACATTCCGTTTTAGCACAATCGAGAAGCACGGCTGT
GATAAAAAGTTGTACGCTAACCTGACATATGCACTGGAAAAAATTAAAAGTGTATTAGCA
AATAAACTGTGCTAG
Protein sequence:
INFQDHTKIILCPLMQAVTYIDVEKNFRTFRFSTIEKHGCDKKLYANLTYALEKIKSVLA
NKLC