New model in OGS2.0 | DPOGS212091  |
---|---|
Genomic Position | scaffold1562:+ 25058-25189 |
See gene structure | |
CDS Length | 132 |
Paired RNAseq reads   | 0 |
Single RNAseq reads   | 99 |
Migratory profiles | Query via corresponding ESTs |
Best Bmobyx hit | BGIBMGA006724 (1e-13) |
Best Drosophila hit   | rolled, isoform F (2e-10) |
Best Human hit | mitogen-activated protein kinase 1 (8e-09) |
Best NR hit (blastp)   | extracellular regulated MAP kinase [Bombyx mori] (5e-16) |
Best NR hit (blastx)   | extracellular regulated MAP kinase [Bombyx mori] (9e-11) |
GeneOntology terms    | GO:0004707 MAP kinase activity GO:0005634 nucleus GO:0005737 cytoplasm GO:0007169 transmembrane receptor protein tyrosine kinase signaling pathway GO:0004705 JUN kinase activity GO:0007369 gastrulation GO:0008595 anterior/posterior axis specification, embryo GO:0008293 torso signaling pathway GO:0000165 MAPKKK cascade GO:0006468 protein amino acid phosphorylation GO:0006355 regulation of transcription, DNA-dependent GO:0045467 R7 cell development GO:0004674 protein serine/threonine kinase activity GO:0006916 anti-apoptosis GO:0007507 heart development GO:0045500 sevenless signaling pathway GO:0007173 epidermal growth factor receptor signaling pathway GO:0050803 regulation of synapse structure and activity GO:0005524 ATP binding GO:0007474 imaginal disc-derived wing vein specification GO:0007067 mitosis GO:0007476 imaginal disc-derived wing morphogenesis GO:0046534 positive regulation of photoreceptor cell differentiation GO:0005515 protein binding GO:0030054 cell junction GO:0034334 adherens junction maintenance GO:0050804 regulation of synaptic transmission GO:0048149 behavioral response to ethanol GO:0006974 response to DNA damage stimulus GO:0007552 metamorphosis |
InterPro families   | ND |
Orthology group | MCL40101 |
Nucleotide sequence:
ATGGCCGAGGCTGCAGCTGCTGCTAGCACTAATCCCAATGCGGAGATTGTGCGGGGTCAG
GTGTTCGAAGTTGGGCCTAGATACAAGAGCTTGCAGTACATTGGGGAAGGAGCCTATGGC
ATGGTTGTGTAA
Protein sequence:
MAEAAAAASTNPNAEIVRGQVFEVGPRYKSLQYIGEGAYGMVV