| New model in OGS2.0 | DPOGS201530 |
|---|---|
| Genomic Position | scaffold64:+ 94709-95279 |
| See gene structure | |
| CDS Length | 309 |
| Paired RNAseq reads | 52 |
| Single RNAseq reads | 2513 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA002707 (4e-34) |
| Best Drosophila hit | bunched, isoform C (2e-21) |
| Best Human hit | TSC22 domain family protein 4 (1e-11) |
| Best NR hit (blastp) | hypothetical protein AaeL_AAEL007682 [Aedes aegypti] (2e-23) |
| Best NR hit (blastx) | GM26174 [Drosophila sechellia] (5e-19) |
| GeneOntology terms | GO:0005737 cytoplasm GO:0001751 compound eye photoreceptor cell differentiation GO:0008101 decapentaplegic receptor signaling pathway GO:0035282 segmentation GO:0042803 protein homodimerization activity GO:0046843 dorsal appendage formation GO:0007422 peripheral nervous system development GO:0005634 nucleus GO:0048749 compound eye development GO:0001709 cell fate determination GO:0003702 RNA polymerase II transcription factor activity GO:0048477 oogenesis GO:0007304 chorion-containing eggshell formation GO:0009996 negative regulation of cell fate specification GO:0030707 ovarian follicle cell development GO:0048102 autophagic cell death GO:0035071 salivary gland cell autophagic cell death GO:0003700 sequence-specific DNA binding transcription factor activity GO:0006355 regulation of transcription, DNA-dependent GO:0045746 negative regulation of Notch signaling pathway GO:0007297 ovarian follicle cell migration GO:0043066 negative regulation of apoptosis GO:0030307 positive regulation of cell growth GO:0008284 positive regulation of cell proliferation |
| InterPro families | IPR000580 TSC-22 / Dip / Bun |
| Orthology group | MCL18973 |
Nucleotide sequence:
ATGATCGACGTTATAAAACCCCGCGATGGCTGCCTCTACGAGATCAGACAGAAGGGACAG
AGAGACCCCTGTTACGTGGTCGTCCCTGATACAACAGATCTGGTTAAGAGCCACTTAATG
TTCGCGGTGCGTGAGGAGGTGGAGGTCCTCAAGGAACGCATCGCCGAACTCATGGAGAGG
ATCAACCAGCTGGAAGTTGAGAACAGTTACCTGCGAGCTCACGCCAGCCAGGACACGCTG
GCGCAGCTGCCAGCCGCCGGCGCGAAGCCTCCGCCGCAACCGCAGGGCCCTCAGCCGCCG
GTGTCATAG
Protein sequence:
MIDVIKPRDGCLYEIRQKGQRDPCYVVVPDTTDLVKSHLMFAVREEVEVLKERIAELMER
INQLEVENSYLRAHASQDTLAQLPAAGAKPPPQPQGPQPPVS