| New model in OGS2.0 | DPOGS205512 |
|---|---|
| Genomic Position | scaffold699:+ 84168-84353 |
| See gene structure | |
| CDS Length | 186 |
| Paired RNAseq reads | 2 |
| Single RNAseq reads | 194 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | ND |
| Best Drosophila hit | happyhour, isoform A (8e-13) |
| Best Human hit | mitogen-activated protein kinase kinase kinase kinase 3 (4e-09) |
| Best NR hit (blastp) | mitogen-activated protein kinase kinase kinase kinase, putative [Pediculus humanus corporis] (6e-12) |
| Best NR hit (blastx) | mitogen-activated protein kinase kinase kinase kinase, putative [Pediculus humanus corporis] (7e-11) |
| GeneOntology terms | GO:0004674 protein serine/threonine kinase activity GO:0004702 receptor signaling protein serine/threonine kinase activity GO:0006468 protein amino acid phosphorylation GO:0005083 small GTPase regulator activity GO:0005524 ATP binding GO:0004672 protein kinase activity GO:0032008 positive regulation of TOR signaling cascade GO:0042059 negative regulation of epidermal growth factor receptor signaling pathway GO:0048149 behavioral response to ethanol |
| InterPro families | ND |
| Orthology group | ND |
Nucleotide sequence:
ATGGCGCATAGTGGTGGTGTTTTAAGTTCAGATATATCTAGAAGAAATCCTCAAGATGAG
TACGAGCTCATTCAGAGAATTGGTTCGGGCACTTACGGAGATGTGTACAAGGTAGGAGAC
CTTTCTATCTCTATTTTTTCTCATCAGCAATCCATTAGGAGTAACAATACACAACTTTGT
GGGTGA
Protein sequence:
MAHSGGVLSSDISRRNPQDEYELIQRIGSGTYGDVYKVGDLSISIFSHQQSIRSNNTQLC
G