New model in OGS2.0 | DPOGS200878  |
---|---|
Genomic Position | scaffold1309:- 1045-1194 |
See gene structure | |
CDS Length | 150 |
Paired RNAseq reads   | 3 |
Single RNAseq reads   | 19 |
Migratory profiles | Query via corresponding ESTs |
Best Bmobyx hit | BGIBMGA009868 (4e-13) |
Best Drosophila hit   | ND |
Best Human hit | ND |
Best NR hit (blastp)   | PREDICTED: similar to troponin C type IIb [Nasonia vitripennis] (6e-08) |
Best NR hit (blastx)   | PREDICTED: similar to troponin C type IIb [Nasonia vitripennis] (2e-08) |
GeneOntology terms   | ND |
InterPro families   | IPR011992 EF-hand-like domain |
Orthology group | MCL40469 |
Nucleotide sequence:
ATGTTCGACTCGAACAAGCAGGGAAGAATTGAGAAGGAGAAAGTGCGTACTATCCTGAAC
ACGATGGTACACAGCTTCGATGACAACGAGCTGGACCAGAGGCTGGAGACCGAGGATGTT
GACGGTAATTATAACCAAAAAATACCATAA
Protein sequence:
MFDSNKQGRIEKEKVRTILNTMVHSFDDNELDQRLETEDVDGNYNQKIP