| New model in OGS2.0 | DPOGS211501 |
|---|---|
| Genomic Position | scaffold1787:- 30847-31268 |
| See gene structure | |
| CDS Length | 174 |
| Paired RNAseq reads | 0 |
| Single RNAseq reads | 3 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA003811 (5e-24) |
| Best Drosophila hit | CG18599 (5e-19) |
| Best Human hit | homeobox protein Nkx-6.2 (3e-10) |
| Best NR hit (blastp) | PREDICTED: similar to GA15009-PA [Tribolium castaneum] (3e-18) |
| Best NR hit (blastx) | PREDICTED: similar to GA15009-PA [Tribolium castaneum] (3e-18) |
| GeneOntology terms | GO:0003700 sequence-specific DNA binding transcription factor activity GO:0005634 nucleus GO:0043565 sequence-specific DNA binding GO:0006355 regulation of transcription, DNA-dependent |
| InterPro families | IPR009057 Homeodomain-like IPR012287 Homeodomain-related IPR001356 Homeobox IPR017970 Homeobox, conserved site |
| Orthology group | MCL16068 |
Nucleotide sequence:
ATGGTCGGGCCGGAGAGGCTGTACCTGGCACACGCGCTGCAACTCACAGAGGCACAGGTG
AAGGTCTGGTTCCAGAATCGGCGCATAAAATGGCGGAAGCACCACCTGGAAGTGACGCAG
CAGCGGCTGGCTGTGCTGCAGAGGCACAGGCCGGACGAGAGGGACGACGTATAG
Protein sequence:
MVGPERLYLAHALQLTEAQVKVWFQNRRIKWRKHHLEVTQQRLAVLQRHRPDERDDV