DPGLEAN16059 in OGS1.0

New model in OGS2.0DPOGS210007 
Genomic Positionscaffold1997:- 9567-10196
See gene structure
CDS Length630
Paired RNAseq reads  0
Single RNAseq reads  1
Migratory profilesQuery via corresponding ESTs
Best Bmobyx hitBGIBMGA008388 (9e-34)
Best Drosophila hit  ND
Best Human hitND
Best NR hit (blastp)  PREDICTED: similar to conserved hypothetical protein, partial [Acyrthosiphon pisum] (1e-45)
Best NR hit (blastx)  PREDICTED: similar to conserved hypothetical protein, partial [Acyrthosiphon pisum] (6e-45)
GeneOntology terms

  
GO:0008150 biological_process
GO:0005575 cellular_component
GO:0003674 molecular_function
InterPro families  IPR006912 Putative harbinger transposase-derived nuclease
Orthology groupMCL18702

Nucleotide sequence:

ATGGATATCAACTACAAGAAGTTCTTTAGCATCGTTTTATTAGCCGTCGTGGATGCAAAA
TACAAATTTGTGATTGTAGATGTCGGAGCATATGGTCGAAATAGCGATGGCGGTACACTT
CAAAGCTCTAAATTTGGTTCGAAACTACGTAATGGTTTTTTATGCATACCACCGGAAAAG
GCTTTACCACATTCAACTCAAAAATTACCTAACGTATTTGTCGCCGATGAAGCCTTTCCA
CTAACAGAAAATATTATGAGACCATACCCCTCACATCTTTTAAATGATGAAAAAAAAAGG
ATATTCAATTATCGCTTAAGTAGAGAACGGCGTATTGTAGAAAATGCTTTCGGAATGTTA
CAAGAAAGATTTGAATTATTTCAAAAAGGTATAAAAGTTCAACCAAAGTACATTAACAAC
ATTATACTAGCAAGCACGTGTTTGCATAACTTTATCATTGATGGTCATTCTATGGACGCC
CTTAGCTCTAATACTAATAATGCAATCGATAGAACCAATGATTCAGTTTTTAACAATCTG
GATGGGATGGTTGTAAGAGATTGTTTCACGGAATATTTTTCTAATGTTGGTAACGTGTAC
TGGCAAAATGAAATTGTTAATAGATGTTAG

Protein sequence:

MDINYKKFFSIVLLAVVDAKYKFVIVDVGAYGRNSDGGTLQSSKFGSKLRNGFLCIPPEK
ALPHSTQKLPNVFVADEAFPLTENIMRPYPSHLLNDEKKRIFNYRLSRERRIVENAFGML
QERFELFQKGIKVQPKYINNIILASTCLHNFIIDGHSMDALSSNTNNAIDRTNDSVFNNL
DGMVVRDCFTEYFSNVGNVYWQNEIVNRC