| New model in OGS2.0 | DPOGS211580 |
|---|---|
| Genomic Position | scaffold11651:- 842-1060 |
| See gene structure | |
| CDS Length | 219 |
| Paired RNAseq reads | 1 |
| Single RNAseq reads | 428 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA006515 (3e-25) |
| Best Drosophila hit | scribbled, isoform M (1e-24) |
| Best Human hit | protein scribble homolog isoform b (1e-19) |
| Best NR hit (blastp) | hypothetical protein TcasGA2_TC011397 [Tribolium castaneum] (5e-23) |
| Best NR hit (blastx) | hypothetical protein TcasGA2_TC011397 [Tribolium castaneum] (6e-21) |
| GeneOntology terms | GO:0042221 response to chemical stimulus GO:0042048 olfactory behavior GO:0006963 positive regulation of antibacterial peptide biosynthetic process GO:0005918 septate junction GO:0008283 cell proliferation GO:0016327 apicolateral plasma membrane GO:0016333 morphogenesis of follicular epithelium GO:0016331 morphogenesis of embryonic epithelium GO:0016334 establishment or maintenance of polarity of follicular epithelium GO:0016336 establishment or maintenance of polarity of larval imaginal disc epithelium GO:0016332 establishment or maintenance of polarity of embryonic epithelium GO:0016328 lateral plasma membrane GO:0016335 morphogenesis of larval imaginal disc epithelium GO:0045197 establishment or maintenance of epithelial cell apical/basal polarity GO:0005515 protein binding GO:0007391 dorsal closure GO:0050803 regulation of synapse structure and activity GO:0008406 gonad development GO:0007280 pole cell migration GO:0008105 asymmetric protein localization GO:0035003 subapical complex GO:0005737 cytoplasm GO:0045186 zonula adherens assembly GO:0016323 basolateral plasma membrane GO:0008285 negative regulation of cell proliferation GO:0051726 regulation of cell cycle GO:0001738 morphogenesis of a polarized epithelium GO:0007472 wing disc morphogenesis GO:0048749 compound eye development GO:0045571 negative regulation of imaginal disc growth GO:0035088 establishment or maintenance of apical/basal cell polarity GO:0050680 negative regulation of epithelial cell proliferation GO:0000902 cell morphogenesis GO:0019991 septate junction assembly GO:0031594 neuromuscular junction GO:0007464 R3/R4 cell fate commitment GO:0001737 establishment of imaginal disc-derived wing hair orientation GO:0042067 establishment of ommatidial planar polarity GO:0045169 fusome |
| InterPro families | IPR001611 Leucine-rich repeat |
| Orthology group | MCL24222 |
Nucleotide sequence:
ATGTTTCGATGTATACCTTTGTTCAAATGTAATCGCCAAGTGGAATGTGTAGACAAGCGG
CATTGCTCCTTGCCAACAGTACCTGAAGACATTTTACGATATTCCAGGAGTTTGGAGGAA
CTTTTTCTAGATGCAAATCATATACGAGATTTACCGAAAGTAAGTTGTGTTTTGATTAAA
TTACAATATTCTTGTCGTGGGCGTTCACCTTATCAGTAG
Protein sequence:
MFRCIPLFKCNRQVECVDKRHCSLPTVPEDILRYSRSLEELFLDANHIRDLPKVSCVLIK
LQYSCRGRSPYQ