| New model in OGS2.0 | DPOGS205762 |
|---|---|
| Genomic Position | scaffold2210:+ 2223-2411 |
| See gene structure | |
| CDS Length | 117 |
| Paired RNAseq reads | 0 |
| Single RNAseq reads | 26 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA009961 (1e-13) |
| Best Drosophila hit | dunce, isoform G (6e-12) |
| Best Human hit | cAMP-specific 3',5'-cyclic phosphodiesterase 4B isoform 3 (2e-10) |
| Best NR hit (blastp) | PREDICTED: similar to CG32498-PI [Nasonia vitripennis] (8e-11) |
| Best NR hit (blastx) | PREDICTED: similar to CG32498-PI [Nasonia vitripennis] (3e-10) |
| GeneOntology terms | GO:0048477 oogenesis GO:0007610 behavior GO:0004115 3',5'-cyclic-AMP phosphodiesterase activity GO:0007611 learning or memory GO:0009187 cyclic nucleotide metabolic process GO:0004114 3',5'-cyclic-nucleotide phosphodiesterase activity GO:0007619 courtship behavior GO:0019933 cAMP-mediated signaling GO:0007612 learning GO:0008355 olfactory learning GO:0045475 locomotor rhythm GO:0048149 behavioral response to ethanol GO:0000003 reproduction GO:0007268 synaptic transmission GO:0007623 circadian rhythm GO:0007617 mating behavior GO:0008306 associative learning GO:0046958 nonassociative learning GO:0007613 memory GO:0007165 signal transduction GO:0048675 axon extension GO:0007614 short-term memory GO:0001661 conditioned taste aversion |
| InterPro families | ND |
| Orthology group | MCL20511 |
Nucleotide sequence:
ATGAAGCTAGCTTTAGAAACCGTCGAAGAGCTGGACTGGTGCTTGGACCAGCTCGAGACG
ATTCAAACACATCGCTCCGTCTCCGACATGGCTTCGCTCAAGAACGACGTGAAATAA
Protein sequence:
MKLALETVEELDWCLDQLETIQTHRSVSDMASLKNDVK