DPGLEAN16719 in OGS1.0

New model in OGS2.0DPOGS205248 
Genomic Positionscaffold1389:+ 55702-59764
See gene structure
CDS Length1617
Paired RNAseq reads  179
Single RNAseq reads  392
Migratory profilesQuery via corresponding ESTs
Best Bmobyx hitBGIBMGA008755 (0.0)
Best Drosophila hit  CG12299 (3e-27)
Best Human hitzinc finger protein 317 isoform 1 (5e-25)
Best NR hit (blastp)  hypothetical protein BRAFLDRAFT_65421 [Branchiostoma floridae] (7e-33)
Best NR hit (blastx)  hypothetical protein BRAFLDRAFT_65421 [Branchiostoma floridae] (3e-39)
GeneOntology terms

  
GO:0008270 zinc ion binding
GO:0005622 intracellular
GO:0003676 nucleic acid binding
InterPro families


  
IPR007087 Zinc finger, C2H2-type
IPR012934 Zinc finger, AD-type
IPR015880 Zinc finger, C2H2-like
IPR013087 Zinc finger, C2H2-type/integrase, DNA-binding
Orthology groupMCL40323

Nucleotide sequence:

ATGGCCGATTTAGACATACCAAAGAAAGTTAAAGGCCCTTTAATTGATCCGGCGCTGTGT
AGATGCTGTCGGTCTATAAAACGATGCCGTTTGTTGACCACGGAGTACGAGTATATGGGT
TCTAAAGAGATTTATTCCGATATGTTTATGGATGTATTTGGTTTACTTTTGACTCATCTC
GATGGTGATAACAAAGATTCCGCAATATGTGCCACCTGTGTGTCCCGACTGAGAGAAGCG
ATAGCATTCAAACGACAGGTTCTTCAATCGGAACAGATGTTCATCGAGTCGCTTCAGAAT
AGAGAGGAAATAGCTAACATTAAGCTCGAGATAAAAGTTGAGCCGTCCGGTGATGAGATT
GATGACAATCATGATGAAGATATAAATGTATCAGAGATGTTGAATGATGTTCAGGAGACA
AAGATATTAGGTGACGGTAACAGCGAGATGTTCCATATAAAGTTGAAATCGAATAACAAA
ATAAGCAAACTATTAAGGACGAGTAAGATGAAGGCAAAGGAAAAACCATCGCGGCAAAAG
AAGAAGCTGTCACAGAAGCAAATAATTGATCACGACGTAATGGCTCTGAAGAATACGATC
GAGATAGTGAAATGTTCGTATGTCTGTCCCTTCCACAACCGGATTAGCTTCTACTACTGC
TACTACTGCAAAGACCAGTTCACGAACCCCATGGAATTAAGGGAACACACCCTGACCCAC
GATCCCAGGGAACTGTTCGAGATGACGATAGAAAATAAGAAGATACCAAAGATAGACATC
ACTAGGATCGATTGCCGGCTGTGCGCGGAGAAAATCGATGATTTGGATACGCTGAAACTA
CACCTGAGCAATGATCACGACGTAGTGTTGTACCCAGTTAAGAACGAGTTCCTGAAATTT
AGGTTATCACTAACTAATCTCACTTGCACGGAGTGTTATAGCGTCTTTCCATACTTCGAT
GCGCTGAAGAAGCATATGGTGGACCATTTTGGTACTTACACGTGCGACATATGCGGCGCC
TGCTTCCTGGAACAGGCGTCGCTGAGGACCCACATCAAGAACCACAGCAAGGTAGACGCG
AACTTCCCCTGCGAGATATGCGGGAAGAATTTGAAATCGAAATACAGCAGAGGTCTCCAC
GTGGCCACTGTGCACGAAAAAAAACCGACTGTGAACTGCTACAAGTGCGACTCGAGTTTC
TTGTCCTACGCTCTAAGGAACAGACACCTGATCGAGATACACGGCGACAAGAGGACGTTC
CCGTGTAAGCTGTGTGACAAAGTTTACAATCGGCGGAAGACGTTGATGGAACATAACAGG
AGGAACCACCTCAAGGTGTACAGACACCAGTGTGAGCTCTGCGACCAGAGGTTCTACCTG
CCATCGAGACTGAAAGAACACATGGCAACTCACACCGGCGAGAGGAACTACAGGTGCGAG
TTTTGCGACAAAAGCTATCCCAGACAGCAATCGCTGCAAGAACACGTCCGAATACATAAC
ATAGAGAGGAGGTACAAGTGCAGCGTCTGCGAGACGACGTTCAGCCAGAGCGGGGCCCTG
CAGACTCATATGAAGGCAAAGCACCAGACGTTCGATGCTGACGGCAGTTTCAACTGA

Protein sequence:

MADLDIPKKVKGPLIDPALCRCCRSIKRCRLLTTEYEYMGSKEIYSDMFMDVFGLLLTHL
DGDNKDSAICATCVSRLREAIAFKRQVLQSEQMFIESLQNREEIANIKLEIKVEPSGDEI
DDNHDEDINVSEMLNDVQETKILGDGNSEMFHIKLKSNNKISKLLRTSKMKAKEKPSRQK
KKLSQKQIIDHDVMALKNTIEIVKCSYVCPFHNRISFYYCYYCKDQFTNPMELREHTLTH
DPRELFEMTIENKKIPKIDITRIDCRLCAEKIDDLDTLKLHLSNDHDVVLYPVKNEFLKF
RLSLTNLTCTECYSVFPYFDALKKHMVDHFGTYTCDICGACFLEQASLRTHIKNHSKVDA
NFPCEICGKNLKSKYSRGLHVATVHEKKPTVNCYKCDSSFLSYALRNRHLIEIHGDKRTF
PCKLCDKVYNRRKTLMEHNRRNHLKVYRHQCELCDQRFYLPSRLKEHMATHTGERNYRCE
FCDKSYPRQQSLQEHVRIHNIERRYKCSVCETTFSQSGALQTHMKAKHQTFDADGSFN