New model in OGS2.0 | DPOGS203696  |
---|---|
Genomic Position | scaffold7309:- 1990-3545 |
See gene structure | |
CDS Length | 330 |
Paired RNAseq reads   | 73 |
Single RNAseq reads   | 280 |
Migratory profiles | Query via corresponding ESTs |
Best Bmobyx hit | BGIBMGA003489 (9e-44) |
Best Drosophila hit   | patj, isoform B (2e-37) |
Best Human hit | multiple PDZ domain protein (2e-31) |
Best NR hit (blastp)   | GK20329 [Drosophila willistoni] (4e-40) |
Best NR hit (blastx)   | GK20329 [Drosophila willistoni] (1e-35) |
GeneOntology terms    | GO:0005737 cytoplasm GO:0007163 establishment or maintenance of cell polarity GO:0016333 morphogenesis of follicular epithelium GO:0005635 nuclear envelope GO:0016324 apical plasma membrane GO:0016334 establishment or maintenance of polarity of follicular epithelium GO:0045186 zonula adherens assembly GO:0045196 establishment or maintenance of neuroblast polarity GO:0045179 apical cortex GO:0005886 plasma membrane GO:0016332 establishment or maintenance of polarity of embryonic epithelium GO:0035003 subapical complex GO:0007043 cell-cell junction assembly GO:0005918 septate junction GO:0002009 morphogenesis of an epithelium GO:0045176 apical protein localization GO:0005515 protein binding GO:0001736 establishment of planar polarity GO:0045494 photoreceptor cell maintenance GO:0034332 adherens junction organization GO:0008594 photoreceptor cell morphogenesis GO:0005875 microtubule associated complex |
InterPro families   | IPR001478 PDZ/DHR/GLGF |
Orthology group | ND |
Nucleotide sequence:
ATGTGGGCGTCCGAGCCACAGATTATTGAGCTGGTGAAGGGCGAACGAGGTTTGGGCTTC
TCCATCCTTGACTACCAGGATCCCCTGCGTCCCTCGCACACCCTGGTGGTAATACGGTCC
CTGGTGCCGGGCGGCGTGGCCCAGCAGGACGGCAGGCTCATACCAGGCGACAGGCTCCTC
TTCAACTTGGAGAACGCTAGTCTAGAACAAGCCGTCGCTGCTTTAAAGGGCGCCCCCCGT
GGCGTGGTCCGTATTGGCGTGGCGAAGCCTCTACCACTAACCGACGGTCCCCCACCACTA
CCGGCTACCTCCCCACCACCACACCACTAG
Protein sequence:
MWASEPQIIELVKGERGLGFSILDYQDPLRPSHTLVVIRSLVPGGVAQQDGRLIPGDRLL
FNLENASLEQAVAALKGAPRGVVRIGVAKPLPLTDGPPPLPATSPPPHH