DPGLEAN16940 in OGS1.0

New model in OGS2.0DPOGS208175 
Genomic Positionscaffold472:- 42156-42857
See gene structure
CDS Length351
Paired RNAseq reads  66
Single RNAseq reads  529
Migratory profilesQuery via corresponding ESTs
Best Bmobyx hitBGIBMGA010262 (6e-53)
Best Drosophila hit  dynein light chain 90F (2e-46)
Best Human hitdynein light chain Tctex-type 1 (1e-46)
Best NR hit (blastp)  dynein molecular motor protein light chain 1 [Bombyx mori] (2e-58)
Best NR hit (blastx)  dynein molecular motor protein light chain 1 [Bombyx mori] (8e-60)
GeneOntology terms



















  
GO:0000132 establishment of mitotic spindle orientation
GO:0003774 motor activity
GO:0005515 protein binding
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0005868 cytoplasmic dynein complex
GO:0005874 microtubule
GO:0006810 transport
GO:0006886 intracellular protein transport
GO:0007017 microtubule-based process
GO:0007049 cell cycle
GO:0007067 mitosis
GO:0007399 nervous system development
GO:0008277 regulation of G-protein coupled receptor protein signaling pathway
GO:0019060 intracellular transport of viral proteins in host cell
GO:0032314 regulation of Rac GTPase activity
GO:0042802 identical protein binding
GO:0048812 neuron projection morphogenesis
GO:0050768 negative regulation of neurogenesis
GO:0051301 cell division
GO:0051493 regulation of cytoskeleton organization
InterPro families  IPR005334 Tctex-1
Orthology groupMCL10726

Nucleotide sequence:

ATGGAAGTCAAAGAATGCAATGACTTAACAGAGGAAAATCAATTTATTGTGGATGATGTG
AGTAAAATTATTAAAGAAGCGATTGAGAATTCTATAGGGGGTAATGCATATCAACATAAT
AAGGTAAACCAATGGACATCTGCTGTTGTGGAATCGTGTTTGGGACAACTTACGAAATTG
CAAAAGCCTTATAAGTATATAGTGACATGCACAATAATGCAGAAGAATGGCGCCGGGTTA
CATACAGCCTCTTCCTGTTTTTGGGACAACAATACTGATGGATCCTGCACCGTCCGCTGG
GAGAATAAGACCATGTACTGCATTGTCTCCGTATTTGGATTAGGCATTTGA

Protein sequence:

MEVKECNDLTEENQFIVDDVSKIIKEAIENSIGGNAYQHNKVNQWTSAVVESCLGQLTKL
QKPYKYIVTCTIMQKNGAGLHTASSCFWDNNTDGSCTVRWENKTMYCIVSVFGLGI