New model in OGS2.0 | DPOGS202301  |
---|---|
Genomic Position | scaffold664:+ 92670-102971 |
See gene structure | |
CDS Length | 576 |
Paired RNAseq reads   | 439 |
Single RNAseq reads   | 1538 |
Migratory profiles | Query via corresponding ESTs |
Best Bmobyx hit | BGIBMGA004972 (4e-78) |
Best Drosophila hit   | pointed, isoform D (2e-30) |
Best Human hit | protein C-ets-1 isoform 2 (2e-30) |
Best NR hit (blastp)   | hypothetical protein TcasGA2_TC014509 [Tribolium castaneum] (1e-49) |
Best NR hit (blastx)   | hypothetical protein TcasGA2_TC014509 [Tribolium castaneum] (1e-42) |
GeneOntology terms    | GO:0001666 response to hypoxia GO:0003677 DNA binding GO:0003700 sequence-specific DNA binding transcription factor activity GO:0003702 RNA polymerase II transcription factor activity GO:0005515 protein binding GO:0005634 nucleus GO:0005667 transcription factor complex GO:0006355 regulation of transcription, DNA-dependent GO:0006357 regulation of transcription from RNA polymerase II promoter GO:0006366 transcription from RNA polymerase II promoter GO:0006916 anti-apoptosis GO:0006917 induction of apoptosis GO:0007565 female pregnancy GO:0008284 positive regulation of cell proliferation GO:0009611 response to wounding GO:0009612 response to mechanical stimulus GO:0010552 positive regulation of gene-specific transcription from RNA polymerase II promoter GO:0010715 regulation of extracellular matrix disassembly GO:0016563 transcription activator activity GO:0021854 hypothalamus development GO:0021983 pituitary gland development GO:0030335 positive regulation of cell migration GO:0030578 PML body organization GO:0032355 response to estradiol stimulus GO:0034616 response to laminar fluid shear stress GO:0043565 sequence-specific DNA binding GO:0045648 positive regulation of erythrocyte differentiation GO:0045766 positive regulation of angiogenesis GO:0045786 negative regulation of cell cycle GO:0045893 positive regulation of transcription, DNA-dependent GO:0045941 positive regulation of transcription GO:0045944 positive regulation of transcription from RNA polymerase II promoter GO:0046677 response to antibiotic GO:0048870 cell motility GO:0051272 positive regulation of cellular component movement GO:0060055 angiogenesis involved in wound healing GO:0060206 estrous cycle phase GO:0070301 cellular response to hydrogen peroxide GO:0070555 response to interleukin-1 |
InterPro families    | IPR010993 Sterile alpha motif homology IPR003118 Sterile alpha motif/pointed IPR013761 Sterile alpha motif-type |
Orthology group | MCL18460 |
Nucleotide sequence:
ATGGGAATCAAAGTCATGATGAAAGCTTTCAATAAGCCTAAAGACATCCCATCACAGGTG
CCGCCGCTCACGCCCGGCACCAACAAGAAGATGGCTGAGGCGCTGAAAGCTACCTTCGCC
TCCTGGGAGAAGGAACAGTTACGCCTCGGGGTGCCCAAAGACCCTCGTCAGTGGAGTGAG
GCGGCTGTTGCTGCATGGCTCCGTTGGGCGGCTCGTGAGTTCTCCCTAGAAGGCGTAGCT
CTACAGCAGTTCGCGCGTGCTCAAGGCAAGGATATATGCGCGATGGGAAGAGAGGAATTC
GTGGCCAGAGCACCCGCTTTCATGGGCGATATACTTTGGGAACACCTGGAGATTCTACAA
AAAGACGTGGAGAAGGAACGCTCTCTGCTGGCGAACGTGCCTCCCAATATGTATGAAAGC
AACGTCTGTCTGCCGGAACTGGCCGACTACATCCCGCCGCCCGCCCACCACTACAACAAC
AATAACAATAACACAGGTATGCCCATTATAATAAAACACCAACCAGAGATGCTACCAGCT
GATAGCTGTCAAAGATTGCAACGATACCATAAATAA
Protein sequence:
MGIKVMMKAFNKPKDIPSQVPPLTPGTNKKMAEALKATFASWEKEQLRLGVPKDPRQWSE
AAVAAWLRWAAREFSLEGVALQQFARAQGKDICAMGREEFVARAPAFMGDILWEHLEILQ
KDVEKERSLLANVPPNMYESNVCLPELADYIPPPAHHYNNNNNNTGMPIIIKHQPEMLPA
DSCQRLQRYHK