| New model in OGS2.0 | DPOGS211483 |
|---|---|
| Genomic Position | scaffold33:+ 52462-53207 |
| See gene structure | |
| CDS Length | 282 |
| Paired RNAseq reads | 0 |
| Single RNAseq reads | 94 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA013791 (3e-15) |
| Best Drosophila hit | Nup62 (7e-10) |
| Best Human hit | nuclear pore glycoprotein p62 (5e-10) |
| Best NR hit (blastp) | PREDICTED: similar to conserved hypothetical protein [Nasonia vitripennis] (3e-11) |
| Best NR hit (blastx) | PREDICTED: similar to conserved hypothetical protein [Nasonia vitripennis] (9e-11) |
| GeneOntology terms | GO:0051028 mRNA transport GO:0055085 transmembrane transport GO:0051425 PTB domain binding GO:0043407 negative regulation of MAP kinase activity GO:0046580 negative regulation of Ras protein signal transduction GO:0008285 negative regulation of cell proliferation GO:0042059 negative regulation of epidermal growth factor receptor signaling pathway GO:0005737 cytoplasm GO:0005856 cytoskeleton GO:0005634 nucleus GO:0005643 nuclear pore GO:0006810 transport GO:0015031 protein transport GO:0017056 structural constituent of nuclear pore GO:0007569 cell aging GO:0030529 ribonucleoprotein complex GO:0016477 cell migration |
| InterPro families | IPR007758 Nucleoporin, Nsp1-like, C-terminal |
| Orthology group | ND |
Nucleotide sequence:
ATGTACCTAAGTGTTGTTGTTCTCATCGCCAGATCCCAAGCCCCTCCAGCGGCTATAACT
TCAATAAATTTCGCGGAACTCCAGGAAAATATCAATAAGTGGAGTTTGTCTTTGGAGGAA
CAGGAGAGGGTTTTCTACAGACAAGCGACTACACTCAACGCCTGGGACAGACTATCGGCG
AGTAACGGTGAAAAGGTTGGCAACGCATCCGCAACATCTCTTATGTTGCAGATGGCCATG
GGCGACAGTGACTCCTGCCCAAGTAGACCGTCTGCTGCGTAG
Protein sequence:
MYLSVVVLIARSQAPPAAITSINFAELQENINKWSLSLEEQERVFYRQATTLNAWDRLSA
SNGEKVGNASATSLMLQMAMGDSDSCPSRPSAA