DPGLEAN18071 in OGS1.0

New model in OGS2.0DPOGS205572 
Genomic Positionscaffold541:+ 28153-38236
See gene structure
CDS Length1356
Paired RNAseq reads  85
Single RNAseq reads  266
Migratory profilesQuery via corresponding ESTs
Best Bmobyx hitBGIBMGA008045 (1e-93)
Best Drosophila hit  CG32052 (3e-89)
Best Human hitacid sphingomyelinase-like phosphodiesterase 3a precursor (4e-54)
Best NR hit (blastp)  AGAP005806-PA [Anopheles gambiae str. PEST] (2e-106)
Best NR hit (blastx)  AGAP005806-PA [Anopheles gambiae str. PEST] (1e-104)
GeneOntology terms  GO:0004767 sphingomyelin phosphodiesterase activity
InterPro families  ND
Orthology groupMCL11021

Nucleotide sequence:

ATGACTCCAAGCAGCTTTACTCTTTACATCACCAGCCTGCTGTGGCTTGATCTGACACAC
GCTAAAATTGGTTACTTCTGGCACATCACAGATCTTCATTATGACCCGTTCCACAACTCC
CTCGAGTTACATAGAGGTTGCAAGCACAGTCGTGGCAGCAATGAGCACAGCCACCGCAAT
GGCCGCCACCGTGACCACACGTGTGACAGCTCGTGGCCACTCATACAAAGCGCTGCCACA
TTCATGGCTGAACGACATCCTGATACGTTAGAATTTGTACTATGGACCGGGGACATCTTG
TCGTCATCTATGGAACATCTGAGTGATGAAATCAAACTAGAGGCGGTCAGAAACGTAACT
GACATACTAAGTCGTACATTTAGTAGCCAGTTTGTATTTCCAGCATTGGGTCATAACGAT
CCTCCACCATCCAGGAAGTTAGTAGACATGTGGATGCAGTGGCTGCCCACCGAGGCTTTA
CAGACTTTTGAGACAGGTGGTTATTATACCATAGAACAGTCTCACAGCAAACTCCGAATT
GTCGTTCTTAATAGCGTGCTTTGGGCTGGAGGTGCGGCCAAGACTGACGGTCCTCACAGA
GGACGAGCGCAGTGGGAGTGGCTTGAACACGTACTTAGTAAGGCAAGAAGGAAAAACGAA
ATGGTATACTTAGTAGCTCATGCTGGGCTAGGTGTTGAAGAACGTCATAACGCTGGAAGC
TCGTCGGCGTCAGGCGGCGGAGAGCTTACTCCGACTGCTAACGCGAGATTATTGCATGTC
ATCAGAGCATTCAGTGACGTCATCGCCGGCCAGTTCTATGGACATCGGCACGCAGATACA
TTCAGACTTGTTTATAGTGAAGGGCGACCTGTATCGTGGGCGCTTTTAGCACCGTCGCTC
ACTCCACGAGGTGCGGGCAGTGTTTCGAATCCAGGATTAAGGCTTTATAAATTTGAGTCT
AATACAGGAAAAGTATTAGATTATACACAGTATTATCTAGATGTAACTAATACAAGAGGT
GAAGCGCATTGGGCCGTTGAATACAATGTCACACAATATTATGGTCTAAGAGAAGTAAGC
GCAGTGTCATTGGACAATTTGGCTGAGAAGATTAGAAATTATCCAGATAGAACCTATCTT
AACAAGTATTTATCAGCTCTGCGGGTGCGACACGCCACTGATGTATCTGAGTGTGACACT
GCATGTATTCACGTGCATTTCTGTGCGATAACTCGAGCTGATTTCCATGAATTTCGCTCA
TGTGTCCGCAATCCTGCGTCGGCGCTAGCATCGCGCGCGCCTCATACTTCTGCTGCAATT
TTGGTTTACGCCATGATATTTTTGCTATCGTCTTAA

Protein sequence:

MTPSSFTLYITSLLWLDLTHAKIGYFWHITDLHYDPFHNSLELHRGCKHSRGSNEHSHRN
GRHRDHTCDSSWPLIQSAATFMAERHPDTLEFVLWTGDILSSSMEHLSDEIKLEAVRNVT
DILSRTFSSQFVFPALGHNDPPPSRKLVDMWMQWLPTEALQTFETGGYYTIEQSHSKLRI
VVLNSVLWAGGAAKTDGPHRGRAQWEWLEHVLSKARRKNEMVYLVAHAGLGVEERHNAGS
SSASGGGELTPTANARLLHVIRAFSDVIAGQFYGHRHADTFRLVYSEGRPVSWALLAPSL
TPRGAGSVSNPGLRLYKFESNTGKVLDYTQYYLDVTNTRGEAHWAVEYNVTQYYGLREVS
AVSLDNLAEKIRNYPDRTYLNKYLSALRVRHATDVSECDTACIHVHFCAITRADFHEFRS
CVRNPASALASRAPHTSAAILVYAMIFLLSS