DPGLEAN18770 in OGS1.0

New model in OGS2.0DPOGS205397 
Genomic Positionscaffold10729:- 708-4404
See gene structure
CDS Length411
Paired RNAseq reads  601
Single RNAseq reads  2328
Migratory profilesQuery via corresponding ESTs
Best Bmobyx hitBGIBMGA010403 (3e-31)
Best Drosophila hit  aldehyde dehydrogenase (3e-54)
Best Human hitretinal dehydrogenase 2 isoform 2 (8e-55)
Best NR hit (blastp)  mitochondrial aldehyde dehydrogenase [Bombyx mori] (3e-60)
Best NR hit (blastx)  mitochondrial aldehyde dehydrogenase [Bombyx mori] (2e-59)
GeneOntology terms































  
GO:0016491 oxidoreductase activity
GO:0001568 blood vessel development
GO:0001936 regulation of endothelial cell proliferation
GO:0031076 embryonic camera-type eye development
GO:0010628 positive regulation of gene expression
GO:0030324 lung development
GO:0034097 response to cytokine stimulus
GO:0060324 face development
GO:0055114 oxidation reduction
GO:0005737 cytoplasm
GO:0008285 negative regulation of cell proliferation
GO:0021915 neural tube development
GO:0030900 forebrain development
GO:0043065 positive regulation of apoptosis
GO:0001758 retinal dehydrogenase activity
GO:0003007 heart morphogenesis
GO:0004028 3-chloroallyl aldehyde dehydrogenase activity
GO:0008284 positive regulation of cell proliferation
GO:0042904 9-cis-retinoic acid biosynthetic process
GO:0048384 retinoic acid receptor signaling pathway
GO:0048566 embryonic digestive tract development
GO:0030182 neuron differentiation
GO:0030902 hindbrain development
GO:0035115 embryonic forelimb morphogenesis
GO:0042573 retinoic acid metabolic process
GO:0042574 retinal metabolic process
GO:0005634 nucleus
GO:0009855 determination of bilateral symmetry
GO:0009952 anterior/posterior pattern formation
GO:0016331 morphogenesis of embryonic epithelium
GO:0031016 pancreas development
GO:0009954 proximal/distal pattern formation
GO:0014032 neural crest cell development
InterPro families

  
IPR015590 Aldehyde dehydrogenase domain
IPR016161 Aldehyde/histidinol dehydrogenase
IPR016162 Aldehyde dehydrogenase, N-terminal
Orthology groupND

Nucleotide sequence:

ATGGACGCCTCACAGCGAGGGTACCTCATCAACAAACTCGCGGACCTCGTCGAAAGGGAC
AGAGCTTATCTTGCTAGCTTAGAGACGCTGGACAACGGGAAGCCATACCTCGCGGCCTAC
CATGGAGATTTAGCCGGTGTGATCAAGAATCTGAGGTACTACGCGGGCTGGGCCGACAAA
AACCACGGAATGGTACTGCCCGCTGATGGACCATACTTCGCGTACACGAGACACGAACCA
GTCGGTGTTTGTGGTCAGATCATCCCGTGGAACTTCCCACTGTTGATGGCCGCCTGGAAG
CTGGGCCCCGCGCTCGCCGGCGGGAACACGTTGGTGCTGAAACCGGCCGAGCAGACTCCG
CTCACCGCACTGTACCTGGCCCAACTCGTTAAAGTACGGAACGTTAACTAA

Protein sequence:

MDASQRGYLINKLADLVERDRAYLASLETLDNGKPYLAAYHGDLAGVIKNLRYYAGWADK
NHGMVLPADGPYFAYTRHEPVGVCGQIIPWNFPLLMAAWKLGPALAGGNTLVLKPAEQTP
LTALYLAQLVKVRNVN