| New model in OGS2.0 | DPOGS202358 |
|---|---|
| Genomic Position | scaffold12394:- 1085-1258 |
| See gene structure | |
| CDS Length | 174 |
| Paired RNAseq reads | 0 |
| Single RNAseq reads | 2 |
| Migratory profiles | Query via corresponding ESTs |
| Best Bmobyx hit | BGIBMGA000787 (2e-08) |
| Best Drosophila hit | twin of eyeless (6e-09) |
| Best Human hit | paired box protein Pax-5 (5e-09) |
| Best NR hit (blastp) | PREDICTED: similar to Pox neuro CG8246-PA [Tribolium castaneum] (3e-10) |
| Best NR hit (blastx) | PREDICTED: similar to Pox neuro CG8246-PA [Tribolium castaneum] (3e-10) |
| GeneOntology terms | GO:0045449 regulation of transcription GO:0003677 DNA binding GO:0005634 nucleus GO:0006350 transcription GO:0007275 multicellular organismal development |
| InterPro families | IPR009057 Homeodomain-like IPR001523 Paired box protein, N-terminal IPR011991 Winged helix-turn-helix transcription repressor DNA-binding |
| Orthology group | ND |
Nucleotide sequence:
ATGTTTGCGTGGGAAATACGTGAGCGGTTGCTGAGCGCGAGGGTCTGCGAGCCTCACTCC
ATACCCTCAGTGTCATCTGTTAACAGGATATTGCGGAACAGCGGCCTGGTATGGAACGAG
GAAGACGGAAGACACGGTGTGTTTTACATACATATTTTAATTATAACTTGGTGA
Protein sequence:
MFAWEIRERLLSARVCEPHSIPSVSSVNRILRNSGLVWNEEDGRHGVFYIHILIITW