Genomic Position | scaffold13427:+ 89-638 |
---|---|
See gene structure | |
CDS Length | 273 |
Paired RNAseq reads   | 1 |
Single RNAseq reads   | 202 |
Migratory profiles | Query via corresponding ESTs |
Best Bmobyx hit | BGIBMGA014132 (2e-15) |
Best Drosophila hit   | atypical protein kinase C, isoform C (1e-28) |
Best Human hit | protein kinase C iota type (5e-24) |
Best NR hit (blastp)   | atypical protein kinase C [Bombyx mori] (2e-38) |
Best NR hit (blastx)   | atypical protein kinase C [Bombyx mori] (1e-38) |
GeneOntology terms    | GO:0045216 cell-cell junction organization GO:0000133 polarisome GO:0005515 protein binding GO:0007015 actin filament organization GO:0016324 apical plasma membrane GO:0090004 positive regulation of establishment of protein localization in plasma membrane GO:0016044 cellular membrane organization GO:0006468 protein amino acid phosphorylation GO:0042462 eye photoreceptor cell development GO:0005524 ATP binding GO:0005543 phospholipid binding GO:0004674 protein serine/threonine kinase activity GO:0016020 membrane GO:0045197 establishment or maintenance of epithelial cell apical/basal polarity GO:0016740 transferase activity GO:0006916 anti-apoptosis GO:0046326 positive regulation of glucose import GO:0005768 endosome GO:0005634 nucleus GO:0000166 nucleotide binding GO:0005829 cytosol GO:0035089 establishment of apical/basal cell polarity GO:0004697 protein kinase C activity GO:0046872 metal ion binding GO:0032869 cellular response to insulin stimulus GO:0005737 cytoplasm GO:0046903 secretion GO:0007010 cytoskeleton organization GO:0008270 zinc ion binding GO:0006612 protein targeting to membrane GO:0016192 vesicle-mediated transport GO:0023034 intracellular signaling pathway |
InterPro families    | IPR011009 Protein kinase-like domain IPR000961 AGC-kinase, C-terminal IPR017892 Protein kinase, C-terminal |
Orthology group | MCL39222 |
Nucleotide sequence:
GCCGCGTCCGTGCTGAAAGGCTTCCTGAACAAGAGTCCCGTGGAGAGGCTCGGCTGCGGA
GACAACGGCTTCCTCGACATCGTAAACCATCCCTTCTTCAAGAGCATCGAGTGGGAAATG
TTGGAACAGAAGCAGGTGGTGCCGCCGTTCAAGCCGCGCCTGGAGGGTGAGAGGGACCTC
GCCAATTTCCCGCCAGAGTTCACCGACGAGCCCGTACACCTCACACCGGACGACCAGTAC
GTACACCTCATACGCACACGCACGCGCACGTAA
Protein sequence:
AASVLKGFLNKSPVERLGCGDNGFLDIVNHPFFKSIEWEMLEQKQVVPPFKPRLEGERDL
ANFPPEFTDEPVHLTPDDQYVHLIRTRTRT