DPGLEAN19753 in OGS1.0

Genomic Positionscaffold13427:+ 89-638
See gene structure
CDS Length273
Paired RNAseq reads  1
Single RNAseq reads  202
Migratory profilesQuery via corresponding ESTs
Best Bmobyx hitBGIBMGA014132 (2e-15)
Best Drosophila hit  atypical protein kinase C, isoform C (1e-28)
Best Human hitprotein kinase C iota type (5e-24)
Best NR hit (blastp)  atypical protein kinase C [Bombyx mori] (2e-38)
Best NR hit (blastx)  atypical protein kinase C [Bombyx mori] (1e-38)
GeneOntology terms






























  
GO:0045216 cell-cell junction organization
GO:0000133 polarisome
GO:0005515 protein binding
GO:0007015 actin filament organization
GO:0016324 apical plasma membrane
GO:0090004 positive regulation of establishment of protein localization in plasma membrane
GO:0016044 cellular membrane organization
GO:0006468 protein amino acid phosphorylation
GO:0042462 eye photoreceptor cell development
GO:0005524 ATP binding
GO:0005543 phospholipid binding
GO:0004674 protein serine/threonine kinase activity
GO:0016020 membrane
GO:0045197 establishment or maintenance of epithelial cell apical/basal polarity
GO:0016740 transferase activity
GO:0006916 anti-apoptosis
GO:0046326 positive regulation of glucose import
GO:0005768 endosome
GO:0005634 nucleus
GO:0000166 nucleotide binding
GO:0005829 cytosol
GO:0035089 establishment of apical/basal cell polarity
GO:0004697 protein kinase C activity
GO:0046872 metal ion binding
GO:0032869 cellular response to insulin stimulus
GO:0005737 cytoplasm
GO:0046903 secretion
GO:0007010 cytoskeleton organization
GO:0008270 zinc ion binding
GO:0006612 protein targeting to membrane
GO:0016192 vesicle-mediated transport
GO:0023034 intracellular signaling pathway
InterPro families

  
IPR011009 Protein kinase-like domain
IPR000961 AGC-kinase, C-terminal
IPR017892 Protein kinase, C-terminal
Orthology groupMCL39222

Nucleotide sequence:

GCCGCGTCCGTGCTGAAAGGCTTCCTGAACAAGAGTCCCGTGGAGAGGCTCGGCTGCGGA
GACAACGGCTTCCTCGACATCGTAAACCATCCCTTCTTCAAGAGCATCGAGTGGGAAATG
TTGGAACAGAAGCAGGTGGTGCCGCCGTTCAAGCCGCGCCTGGAGGGTGAGAGGGACCTC
GCCAATTTCCCGCCAGAGTTCACCGACGAGCCCGTACACCTCACACCGGACGACCAGTAC
GTACACCTCATACGCACACGCACGCGCACGTAA

Protein sequence:

AASVLKGFLNKSPVERLGCGDNGFLDIVNHPFFKSIEWEMLEQKQVVPPFKPRLEGERDL
ANFPPEFTDEPVHLTPDDQYVHLIRTRTRT