DPGLEAN20544 in OGS1.0

New model in OGS2.0DPOGS210641 
Genomic Positionscaffold1754:- 19315-24210
See gene structure
CDS Length1734
Paired RNAseq reads  213
Single RNAseq reads  590
Migratory profilesQuery via corresponding ESTs
Best Bmobyx hitBGIBMGA001632 (1e-17)
Best Drosophila hit  CG6654 (2e-14)
Best Human hitzinc finger and BTB domain-containing protein 48 (6e-14)
Best NR hit (blastp)  gonadotropin inducible transcription factor, putative [Pediculus humanus corporis] (9e-24)
Best NR hit (blastx)  zinc finger protein [Aedes aegypti] (9e-21)
GeneOntology terms

  
GO:0005622 intracellular
GO:0008270 zinc ion binding
GO:0003676 nucleic acid binding
InterPro families

  
IPR007087 Zinc finger, C2H2-type
IPR015880 Zinc finger, C2H2-like
IPR013087 Zinc finger, C2H2-type/integrase, DNA-binding
Orthology groupMCL39563

Nucleotide sequence:

ATGTCCAACGTCTTGTGTTTTGTATGCTACGGCGCAGTTCATTCGGATATCAGTGACGGA
ACACGAGCTAAATACCGCGACTTCGTCGGCATTAGCCTGTGTCCGGAATCCCAGCTGTGC
TACATATGCTGTCACATACTCAATAAGATGTGTATTTTCAAATCGCTGTGTCTTAAAAGG
AGCACAGACTATCCTATATTTAGCGAAAAAGATATACTAAGATTACATATAACCGAAGTA
AAGACACAAACGATTTGCGATGATGAATGCTGTGAACAACTTAAGGTAGATATAAAGAAT
TACAATGACAACTACGATGAAAATCTATGTGGGAATAACAAAGATATTGGTTCTGATGAG
GATATTAACGGGTACGGCACAGACGATGATAATAATGGTGACATTAATTACTACGAATAT
AACATCAGTGATGCCTATCATGGCAATGAGGATGGAAAACAAAATGGAGGACATACAGAG
GTGGGTTTGAAAGAAGATGTCGTGTTGGAGGATACATTAAATAATGATGTCAACGAAAAT
GACAGAAATGATAGTAATGATGGTAATGATGATAATGATGACCGGAATCATGATGTAATT
AACAAGGATGATGTTAACGTGAGCGATGTGAAGAAAATGAGAAAGAATAGATTAAAGAAA
TCAAAAAGAAGGGGACTTATGAAGATAACTCTGACAGTTGAAGAACAGAGAGCTGAACTA
GAAGCGAAGAGGAAGGAAAAGAAGTACACAGAGGCTGAGTTCAAGTGCTATAATTGTGCT
ATAGGATTCCTGTTCAAGGATACCTACCAGGCGCATATGATGCGTCACGAAGAGTCTAAC
GGTCAATACTCGTGTCCGATATGCACCCTCCGCGTGTCGTCTCTAACGCTGCTCCGCGTC
CACGCCTCCCGTCATGCGGAGCGCTCCGTGTGCGTGAGGTGCGGGGTTCGAGTCCCCGGC
AGGCACCACGTATGTAAGCACACGAGGACCAGGTCCCTGCCCTGCCACATGTGCGCTAGA
CTGTTCACGGACGCGAGTGGTCTCCAACAACATTTAAAACGAGTCCACACCAGCAAGACC
AGCGGCAGACTCCACACCTGTACCGTCTGTGGCGAGACTTACAACACGCAGGCGGCTCTG
AGGACGCATATGATTAAACATATAAAACGAAAATTCCCGTGTGAGCTGTGCCCGTCGGTG
TACAGCAGTCCGTACACCCTGAACCAGCACATGAAGACCCATAACCAGGTGTCGGAGACA
TACTACTGCGAGACCTGCAACGTCAGCTTCACCTCCAGGAAGGGGCTGATGGCTCATAGA
CGGAACACGCTCAAACACCAACAGACCCTCTTCGAGTGTCCGATATGTGGTCGAGTGTGT
CCCAACCAGCGAGCGCTGGCCTCACACATCCAGGCCGTCCACTCGTCCAGCAAGGAGTAC
AGCTGTTCCATGTGCAGCTCCAGCTACACTAGCAGGAAGTCGCTGGTCAGACACGTCGGA
ACGCACAGGAACAGCACAGGCGGGCCGCTGGCTGTGTGTCACCTGTGCGGGAACTGTTTC
AAGGTCGGCCATTACGGGTTATATGTATGGAGCGTTTTATTTGAGAGTTATTTTATGTGT
GATAACGACCTTGAAGGTCCAACTCAAGCAGAAAGACGCGACAATAATGCATCTCACGAA
ACGCCTGGCCCTTCTGGAAAGCCAGATCAAAAGCTGCCCCACATGTACAAATAA

Protein sequence:

MSNVLCFVCYGAVHSDISDGTRAKYRDFVGISLCPESQLCYICCHILNKMCIFKSLCLKR
STDYPIFSEKDILRLHITEVKTQTICDDECCEQLKVDIKNYNDNYDENLCGNNKDIGSDE
DINGYGTDDDNNGDINYYEYNISDAYHGNEDGKQNGGHTEVGLKEDVVLEDTLNNDVNEN
DRNDSNDGNDDNDDRNHDVINKDDVNVSDVKKMRKNRLKKSKRRGLMKITLTVEEQRAEL
EAKRKEKKYTEAEFKCYNCAIGFLFKDTYQAHMMRHEESNGQYSCPICTLRVSSLTLLRV
HASRHAERSVCVRCGVRVPGRHHVCKHTRTRSLPCHMCARLFTDASGLQQHLKRVHTSKT
SGRLHTCTVCGETYNTQAALRTHMIKHIKRKFPCELCPSVYSSPYTLNQHMKTHNQVSET
YYCETCNVSFTSRKGLMAHRRNTLKHQQTLFECPICGRVCPNQRALASHIQAVHSSSKEY
SCSMCSSSYTSRKSLVRHVGTHRNSTGGPLAVCHLCGNCFKVGHYGLYVWSVLFESYFMC
DNDLEGPTQAERRDNNASHETPGPSGKPDQKLPHMYK